(124 intermediate revisions by 17 users not shown)
Line 1:
Line 1:
−
== translations ==
+
{{ArchiveList}}
−
Onething is how it is translated, another thing is the name the translators agree on. There is a reason why the name translation of various things have that literaly. Besides consider that the frase Ero-Sennin, is ussualy translated into Pervetet Hermit or Erotic Hermit, only the dub have usedPervy-Sage.
+
==Structure of the article==
−
Thatiswhyibelieveit is Hermit Mode, notSageMode. But come on and discuss it.[[Usertalk:Gojita]]
Kabuto's sensing prowess is a combination of Sage Mode and Karin's abilities. Kabuto's healing is a combination of Orochimaru's and Karin's abilities. The ability to change your body exists with Juugo's, Orochimaru's, and Suigetsu's abilities. The way Kabuto looks is a combination of Sage Mode, Juugo's DNA and Orochimaru's DNA.
−
==Warts==
+
Given all that, wouldn't it be a much better idea to get rid of the heading "Snake Sage Mode" and use the heading "Kabuto's Sage Mode"? You could even extend it to the whole article:
+
# General description of Sage Mode
+
# Description of Jiraiya's Sage Mode
+
# Description of Naruto's Sage Mode
+
# Description of Kabuto's Sage Mode
+
It would also make it easier to turn the lists in this article into proper paragraphs.--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 18:09, December 15, 2012 (UTC)
−
TowhoeverisremovingthepartsaboutNarutohavingwarts whilein the HermitMode,stop. Theyareseeninhis[http://www.onemanga.com/Naruto/414/11/face, arms, backandlegs]and[http://www.onemanga.com/Naruto/415/15/rightforearm].[[User:Omnibender|Omnibender]]-[[Usertalk:Omnibender|Talk]]17:28,6September2008(UTC)
+
Asofmytopicabove,Idisagreecompletelywiththearticle the wayit isnow. AlsoKabuto'ssensingprowessbeingpartiallyfrom Karin? Now then, that's a speculation. The way I get it, theonlyreasonwhyKabutohasphysicallychangedisduetoOrochimaru'sDNA+SageTransformation.
+
And again, both Sage Modes grant equal advantages, there are no such things as "toad sm" and "snake sm" mentioned in the series--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 20:59, December 15, 2012 (UTC)
−
Thatisbeforehe perfected it [http://www.onemanga.com/Naruto/418/04/]hisshirtisoffandwearingshorts,heisclearlyinhermitmode,andFukasakusaidhimself that onlyhis eyes wheresupposedtochange as itwasthesignofatruesagesothatwouldbewhyhedoesn'thavewarts on those areas anymore. Jiraiya never perfected it that is why he had warts unlike naruto now.[[User:WolfMaster|WolfMaster]] 01:47, 21 January 2009 (UTC)
+
:Isawyourtopic. Webothagreethatthearticleinitscurrentstateisbad.Weagree that thereisnosuchthing as SnakeSageMode.AndIthinkyouagreewiththestructureIproposed,becauseyoumentionedsomethingsimilar.
+
:About Karin. We know that Karin is good at sensing. We know that Kabuto has Karin's DNA. We don't know whether that influences Kabuto's sensing prowess in Sage Mode. It's just an argument '''against''' calling it Snake Sage Mode, and in favour of calling it Kabuto's Sage Mode.
+
:The article in its current form has 12 section headings for the main content! It has general information listed under Toad Sage Mode. It has irrelevant information listed in the usage section. It might as well not have an introduction. It mentions advantages in three sections. It mentions disadvantages for Toad Sage Mode that are actually disadvantages for everyone. It's a mess.
+
:It also ignores that we have essentially seen 4 different versions of Sage Mode. The basic one is the one we see when Fukasaku trains Naruto in Frog Kata, and has the disadvantage that you run out of sage chakra. That problem can be solved by fusing with Fukasaku and Shima as we've seen with Jiraiya (the 2nd version of Sage Mode). Naruto solves the problem with Shadow Clones, making it the 3rd version. Kabuto solves it with Juugo's DNA, making it the 4th version. But wouldn't guess that from the way the article is written.--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 22:05, December 15, 2012 (UTC)
−
ThenItshouldbementionedinthe Hermit Mode Sectionand not the TrueHermit Mode Section. -[[User:Zero2001|Zero]]- [[UserTalk:Zero2001|Talk]] 06:54,21January2009(UTC)
+
::Thatisincorrect.You'relookingatSage Mode aschanging to a different version based on how it's used, but that's not right. We don't know about the Snakeversion of Sage Mode, , imperfect andperfect. Maand Pa on your shoulders is just themusing [[AmphibianSage Technique]] tositontheirshoulder. That is not a different version of Sage Mode.
+
::Also, having subsections is not a problem. We are an encyclopedia, we chronicle information. If that information requires heading sections, then it gets heading sections.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 16:17, December 16, 2012 (UTC)
:::Sage Mode on its own is only useful if you want to rearrange the stone statues of toads. Or if you can prepare Sage Mode in advance; ambush your enemy; and defeat him quickly before you run out of Sage Chakra. So yes, [[Sage Mode]]+[[Amphibian Sage Technique]] is a different version of Sage Mode, because it's far more practical than Sage Mode on its own. Without solutions like Amphibian Sage Technique, Shadow Clones and Sage transformation, all that's left of [[Sage Mode]] is an incomplete technique. So it's not just different uses; it's an incomplete technique with 3 different ways to make it complete.
+
:::So you're saying that heading sections like "advantages" and "disadvantages" are required? You're saying that headings that use the phrase "Snake Sage Mode" are required; even though that's not canon? You're reply ignores the basic fact that sections shouldn't be used if you only have one paragraph of information.
+
:::In the end this article shows that you can't keep adding information to it and hope it remains making sense. Sometimes you have to reorganise the information.--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 20:19, December 16, 2012 (UTC)
−
==Storingnaturalenergy==
+
:::::Mistakenumber1: Assuming things are the same when we are not told otherwise. We don't assume when we aren't told.
−
ItseemslikeNaruto is abletostorenaturalenergy.Sincehejustnowranoutofitfromusingthecompleteversionoftherasenshurikenmeansthathedoesn'thaveanythingcollecting natural energy forhim and thathehasn'thad the chancetofigureouthowtocollectenrgywhilemovingeither.[[User:WolfMaster|WolfMaster]]20:53,23January2009(UTC)
+
:::::Mistakenumber2:No, Sage Mode + Amphibian Sage Technique is ''not''anotherversionofSage Mode. It'sSageModewithtwooldtoadsmergedtoyourshoulder.NarutocouldgoSageModeperfectlywellbyremainingstilland gathering natural energy.Theentire point of the two toads was so one can do so in combat. Naruto has gone into Sage Mode on and offperfectlymultipletimes during the warwithouttheneedofaclone(orjustacloneofhimdoitinstead of his actual body), still perfect Sage Mode.
+
:::::Clarification number 1: If they are required, then yes. They could also be moved into paragraph format, but I feel it's easier to have them in a listed format, that way one wants to know what the disadvantages of Sage Mode is, one just has to go to the article, click the header for disadvantages, and wow look there it is.
+
:::::In the end, the issue I'm having is your belief that there are random versions of Sage Mode when, as of now, we are aware of there only being two and that's the difference between Toad and Snake. Yes, while the name may not be canon, the fact that a perfect Snake Sage has different properties than a Toad Sage is notable (Naruto is a perfect Toad Sage, the only differences is the pigment around his eyes. Meanwhile Kabuto is a perfect Snake Sage, and he gained ''a lot'' of snake features.)--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 20:42, December 16, 2012 (UTC)
−
Naturalenergyiscollectedandstoredautomaticallyandthen used untill it isdepleted. Also I'dwaitawhilelongerbeforeI'dsaythat Narutohasn'tfigured out how to overcome the weakness. He surprised us all in the last chapter and I'msurehe has figured out how to overcome the weakness. Wait before you give up on him. -[[User:Zero2001|Zero]] - [[User Talk:Zero2001|Talk]] 06:38, 24January2009 (UTC)
+
@Ultimate,thosearephysical/visualdifferences,therearenoneinbenefits. Also theformermightbeonlyduetosagetransformation/jugo'sdna/orochimaru'sdna and notacommonresult--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]])21:10, December16,2012 (UTC)
−
If done properly the time it takes to gather Natural energy and the time it takes to deplete should be around the same so that Naruto can continually have Sage chakara avalible to him through the continued replacement of his clones
+
@TheUltimate3
−
== Sage/Hermit Mode--; ==
+
Mistake 1 = Assuming things are different when we have no information that says otherwise. Which means we can only look at what the manga has given us, and that's ONE Sage Mode.
−
Inallhonesty,it'sbasicallythe same thing. When it all boils down, that is the outcome - though since we have no hard evidence; you can dispute that all you wish. Now, I am sure we can all agree upon Naruto doing the impossible over and over - looking both left and right at the same time. How he does this, I can explain (though I bet most of you already know by now). When he left the Frog Mountain, Mount Myokubason (I cannot spell it for the love of god); he created two Kagebunshin to leave behind and collect the natural energy/senjutsu chakra. He had been in Sage Mode and left the mountain, appearing in Konohagakure safe, sound, and in Sage Mode -- as the fight with Pein progresses, he gradually depletes his Sage Chakra. He then takes the scroll that he now has, and uses it toreverse summon one clone from the mountain, and then dispersing it - thus giving him back his sage chakra and regular chakra (just like when happens when they disperse normally, their unused chakra gets split again, and their knowledge does too). So he gets his chakra back and returns into Sage Mode. Looking left and right at the same time; and gathering senjutsu chakrawhilemoving~
+
Mistake2=Thewholepoint of Sage Mode is that it'suselessincombatUNLESS
+
* you arrive at the battle already in Sage Mode (like Naruto did against Pain); or
+
* you manage to buy yourself some time to get into Sage Mode (like the clumsy toad did for Jiraiya; like the Alliance did for Naruto; and which Kurama's Chakra Cloak did for Naruto)
+
and even then you have to make sure that:
+
* you either beat your opponent '''before''' you drop out of Sage Mode; or
+
* you find a solution to the problem that you can't gather natural energy while moving.
+
Buying the time to get into Sage Mode is the easy problem. Trying to maintain Sage Mode is the difficult problem, and without a solution it's useless for combat purposes.
−
Thoughthistransformationwas"imperfect"hewasabletousethesagemodeto it'sfullpotential, as the changeswerejuston the "outside"thiscommentseemsunneasry and notbackedupbyevidence.Hedidntusefrogkatasduringclosecombatasanexampleandbecausethenaturalenergywasntbalancedthereisreason to believeitwasmorethancosmetic
+
Mistake3=IfyouwanttoseeSageModeasnothingmorethan gathering natural energy and mixing it tocreate Sage Chakra which would lead to Sage Mode, than the articleshouldn'tneedanyof the otherinformation. You couldprettymuchcopy and pastFukasaku'sexplanationtoNarutointothisarticleandlockthepage.Alltheotherinformationshouldthenbemovedtotheappropriatecharacterpages.If you're going to argueacertainposition,atleast draw the logical conclusion from it.
−
==ActivatingBody ==
+
Clarificationnumber1 = We are aware of 3 schools of teaching; 3 schools that teach Sage Mode. We now know that the Toads teach Sage Mode and that the Snakes teach Sage Mode. We were never told that these were *different* Sage Modes. The only thing they might teach different are the ways to use Sage Mode, and their preferred solutions to some of the problems associated with Sage Mode.
−
IfFakasukasaidthatitactivates the bodyandthisisthelastpieceofinformationfromhistraining. Soitshouldbeput,andIputlikeeightgatesbecauseitalsoactivates the bodyin a number of wayslikehermitmode. SoIsayweshouldputthatlittlepieceofinformation. [[User:Cooltamerboy|Cooltamerboy]] ([[Usertalk:Cooltamerboy|talk]])21:03,23July2009 (UTC).
+
Clarificationnumber2=Wehaven't been shown what the Snakesteach.Wedon'tevenknowhowapersonthathasbeen taught Sage Mode by the Snakes looks like. Whatwehaveseenistheendresultof:(a)theSageModeastaught by the Snakes;and (b) a shitload of DNAmodifications done byKabutohimself. Infact,Kabuto'sSageModecouldbeseenasahybrid of [[Sage Mode]] and [[SageTransformation]] with no answers to questions like: (i)Whatare the benefits of that combination?; (ii) What are the drawbacks of that combination?; and (iii) How would such a combination change the looks of someone in Sage Mode as taught by the Snakes?.
−
:YourcomparisontotheEightGates is completelyunnecessary.Thefact that Sage Mode provides a number of abilities is mentionedseveraltimes. '''''~[[User:Snapper2|Snapper]][[Usertalk:Snapper2|T]][[Special:Contributions/Snapper2|o]]''''' 21:55,23July2009 (UTC)
+
IntheendKabuto'sSageMode is exactlythesameas[[Sage Mode]]+[[AmphibianSage Technique]] but with the added problem that we can't distinguish between the two. You're drawing the illogical conclusion that one is a different version of Sage Mode while the other is not, based on the same facts and using thesamearguments. The only thing we know for sure is that perfect sage mode taught by the Snakes will lead to a different pigmentation around the eyes, though we don'tknow why and how the pigmentation becomes different. We haven'tbeentoldthatSage Mode taught by the Snakes will lead to different properties (e.g. speed and strength) in Sage Mode.
−
Notnumberofabilities. I mean that it does things to the body other than allow natural chakra which is yetto be explained what it did to the body. It is similar to the eight gates because it also does things to the body. It might even be doing the same things as the Eight Gates. Now you know why? [[User:Cooltamerboy|Cooltamerboy]] ([[User talk:Cooltamerboy|talk]]) 22:08, 23 July 2009 (UTC).
+
Whatwedisagreeabout is basicallythis:
+
* Sage Mode = impractical Sage Mode as Fukasaku taught it to Naruto before trying the [[Amphibian Sage Technique]] and failing
+
* Sage Mode = impractical Sage Mode plus ways to make Sage Mode usable
+
Either way, the article needs rewriting to make it clear.--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 23:31, December 16, 2012 (UTC)
−
:I'd callanythingbeneficialitdoestothebody(ie.improved durability) an ability. Again,comparing it toEightGatesisunnecessary. '''''~[[User:Snapper2|Snapper]][[User talk:Snapper2|T]][[Special:Contributions/Snapper2|o]]'''''03:33, 24July2009 (UTC)
+
I almost completely agree with you, I'd rewritethearticlemyself,butIdon'twanttostart an edit war. Theway it'snowisnotonlyincorrect but confusing/misleading.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]])01:25, December17,2012 (UTC)
−
Ok.Ijusthaveonequestionforyou. Itmighthaveactivatedthesamethingsthat the eightgatesactivatedright(asthethingshermitmodehasdoneareextremelysimilar)?[[User:Cooltamerboy|Cooltamerboy]]([[Usertalk:Cooltamerboy|talk]])23:50, 24July2009(UTC).
+
:Waitforotherstochimeinon opinions andthoughts. Mylargestissuewithwhatisproposedis the ideathatthereare4differentversionsofSageModebasedonifatoadisonyour shoulder or not, but I don't have the patients to continue reading/responding to suchincrediblylongresponses.
+
:Rewriting an article is a bigger task than a single section, wait for others to voice opinions before making a move.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 04:46, December 17, 2012 (UTC)
+
:::I hope that my analogy to ''incomplete technique versus completed technique'' helps with understanding what I mean when I used the word "version".--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 19:11, December 17, 2012 (UTC)
Howisthisarticleconfusing?Idon'tknowhowmuchthis will help but as the article stands now I amfinewithit.Theonlyreasonitisconfusingtoyouguysisbecauseyou'retakingthingsyoudon'thaveaclueabout and adding them to the mix. It should be:
−
:Judgingfromchapter 409 page 11, the sage chakra simply makes the body stronger. The similarities with the gates are just coincidence. [[User:Jacce|Jacce]] | [[User talk:Jacce|Talk]] 06:30, 25 July 2009 (UTC)
+
*SageMode-Toads
+
** mention all we know
+
*** Also make note of the perfect balance and imperfect balance that the two disciples have achieved
+
** acknowledge the traditional method (with a sage toad to aid in process)
+
*** also mention the way Naruto uses it (with clones)
+
* Sage Mode- Snakes
+
** '''Assume that everything Kabuto did then is a product of Sage Mode''' unless/until mentioned/told otherwise. Then annotations can be made.
+
All that information is represented on the articles, it's just that you have all gone too far in dissecting Kabuto's Sage Mode. I realise that the people who always have problems with the way articles are, are the ones that go off on tangents and want to jump the proverbial gun and we don't do that here. Once the information is available to us, where we can reference it, and have evidence then that's when we move, not before. I'm not sure if you guys understand or no, but this is a method that has to be used to streamline content on the wikia so we don't lose credibility in the information that is found here.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 13:05, December 17, 2012 (UTC)
−
Thereisoneortwothingsyouguysseemto overlook. The eight gates is a technique that unleashes the fullpotential of the body by releasing all possible chakra a person has and that is thereasonit damages the body. The gates are placed and used so the body doesn't automatically go all out in a fightandthereforedamageitself.Naruto'ssage/hermitmodeis different in that the energy usedisfrom nature-- added on to his already large normal chakra store. This does NOT include his jinchuriki chakra. The point im trying to make is Naruto isn't damaged by this "natural boost" because he doesn't generate it, he merely collects it and manipulates it for his own use. Now if we were speaking of Naruto's combined Sage/ Nine tail's form- then perhaps he would be damaged internally and be in pain, muchlike Rock lee is in his Eight Gates transformation. The reason being, both the Eight gates and the Jinchuriki chakra are internally stored chakra that are kept that way to prevent damage--- releasing the bulk of both types of chakra is too much damage for both naruto and Lee to take.
+
TheonlythingIcouldadvocateforregardingthispage, is that the imagein the infobox is nolongeraccurate and a neutralone,possiblyjustshowingthemixing/balancingofnatural energy wouldbebetter.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:HyūgaSymbol.svg|20px]][[Usertalk:Cerez365|<sup>(talk)</sup>]]13:09, December17, 2012(UTC)
−
--[[User:Ironspidermke|Ironspidermke]] ([[User talk:Ironspidermke|talk]]) 18:55, March 13, 2010 (UTC)
−
==Thepictures==
+
:@Cerez365...Thatassumptionfliesin the face of everything we've been shown in the manga. Kabuto's appearance was already changing when he put Orochimaru's DNA in himself. And everyone that uses a derivative of Juugo's abilities changes his appearance, just like Juugo himself does. Kabuto is using Sage Mode and Sage Transformation together, just like Jiraiya uses Sage Mode and [[Amphibian Sage Technique]] together. You can't just assume that everything Kabuto does is the result of Sage Mode, because it's explicitly said that it isn't. Why else would the DNA of Juugo, Karin and Suigetsu be mentioned?
−
The HQpicture of Sage Mode Jiraiya,and Sage-Kyuubi Naruto are messed up(Then again,it might just be my computer)
+
:The structureshould be:
+
:* Sage Mode
+
:** Mention all we know (basically everything that Fukasaku explained).
+
:*** Mention the existence perfect sage mode and imperfect sage mode.
+
:*** Mention the existence of 3 places where Sage Mode is taught, and that the pigmentation around the eyes show at which place you learned Sage Mode.
+
:*** Mention that most users have a method of making it more usable in combat.
+
:* Jiraiya's Sage Mode
+
:** Mention that Jiraiya is an imperfect sage, and that he uses the traditional method as taught by the toads to make Sage Mode usable in combat and refer to the article [[Amphibian Sage Technique]].
+
:*Naruto's Sage Mode
+
:** Mention that Naruto is a perfect Sage.
+
:** Mention that Naruto couldn't use the method taught by the toads and had to come up with his own solution: Shadow Clones (and how he used it in his battle with Pain, maybe).
+
:* Kabuto's Sage Mode
+
:** Mention that Kabuto learned Sage Mode from the Snakes; that he would therefore look more like a snake than a toad; and that it's unknown how a Sage would look in its pure Snake form.
+
:** Mention that Kabuto used Juugo's DNA and [[Sage Transformation]] to solve the same problem that Naruto used Shadow Clones for.
+
:** Mention how Kabuto infused himself with DNA from Karin and Suigetsu and refer to the relevant section in Kabuto's character article.
+
:That's a far more usable and canon compliant structure than the current article has. It also prevents unnecessary duplication of information (see advantages and disadvantages sections). It also allows contributors to compare a specific character's use of Sage Mode against the general characteristics of Sage Mode, instead of forcing a reader to compare and contrast various uses of Sage Mode against eachother.--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 14:46, December 17, 2012 (UTC)
−
Nevermind
+
*Kabuto's appearance changed because Orochimaru's cells were fighting to take over Kabuto's body. That has nothing to do with Jūgo. It's akin to Hashirama's cells trying to turn Danzō into a tree, or else have them sprouting his face on his arm and Madara's chest, so you're wrong in that regard.
−
gohanRULEZ23:33, 14August2009(UTC)
+
*It's not an assumption, it'slumpingallthe information together. I did not say they weren't factors into Kabuto's abilities but as this point, we're unable to discern what is what except for what has been told to us:
+
** How do you know that Kabuto is using Sage Transformation and not just using Jūgo's ability to passively absorb chakra? How do you know that that's simply how someone who uses ''snake'' Sage Mode is supposed to look?
+
** How do you know that Kabuto's been using Karin's Mind Eye of the Kagura (which is ridiculously impossible to steal via DNA) and just doesn't possess her ability to heal?
+
** As for Suigetsu, Kabuto was able to copy his [[Hydrification Technique]] and create the [[Body Fluid Shedding Technique]].
+
* There is no such thing as perfect and imperfect Sage Mode. These are terms that we engineered for compartmentalising sake all of which is already mentioned. Ergo, Naruto and Jiraiya's forms don't have to be separated any more than they are now.
+
* Kabuto's:
+
** You're assuming that's not what a "pure" Sage would look like. There's nothing to compare it to, so where are you forming your basis from? SPECULATION
+
** {{Quote|Kabuto assimilated the DNA of Jūgo to replicate his clan's ability to passively absorb natural energy, thus allowing him to continuously collect the energy even while moving.}}
+
** Information about the assimilation of DNA '''unrelated''' to his Sage Mode is mentioned in his article.
+
* Like I've said before, I personally see nothing wrong with the article's structure and the most I would change is a picture or two. We are supposed to chronicle '''what is said in the series''' not the foregone conclusions that we draw on our own.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 16:02, December 17, 2012 (UTC)
Youinsistonusing the phrase "ability to passively absorb natural energy". Fine, substitute that every time I use the phrase [[Sage Transformation]]. It doesn't alter my argument, but you seem to ignore that part in favour of saying that I'm wrong. <s>(BTW, isn't Sage Transformation the name of Juugo's kekkei genkai?)</s>
−
whatsthediferencebetvennormalchakra and sagechakra?by:jaksasage
+
Youacknowledgethattherearefactors contributing to Kabuto's appearance and abilities.Andyetyou fail to draw logical conclusions from that; conclusions that are consistent with themanga.
+
# We know how a perfect toad sage looks like: perfectly human except for the pigmentation around the eyes. The logical conclusion is that it's the same for a perfect snake sage. Is that speculation? Perhaps, but the significant part is that it's '''less speculative than the opposite conclusion''' (which would be that a snake sage is supposed to look like Kabuto did).
+
# We know that quite a few things that Kabuto assimilated will change your appearance. Sage Mode is just one of several factors that change Kabuto's appearance. The logical conclusion is that we're seeing Kabuto's Sage Mode. The illogical conclusion is that we're seeing "Snake Sage Mode".
+
# The manga says that there are 3 places that teach Sage Mode. The manga doesn't say that there are 3 '''different''' Sage Modes corresponding to 3 '''different''' animals. The logical conclusion is that there is only '''one Sage Mode'''.
+
# The manga is pretty clear about the fact that Sage Mode needs '''something''' to make it useful in combat. It's why I referred to Sage Mode as an incomplete technique (as well as to clarify my use of the word "version"). The manga has shown us three ways:
Given this information '''from the manga''', it makes sense to treat the three times we've seen Sage Mode used in combat (the "completed" sage mode) just as important as the ("incomplete") Sage Mode.
−
:Inmyunderstandingnormalchakrachakra=physicalenergy+spiritual.Inotherwords,itissimplyyourmentalandphysicalpotentialmanifestedinto"chakraenergy"foraninja'suse.Sagechakraiswhenaninjalearnssenjutsu and learnstogather the energyallaroundus...dubbed "nature"or "sage" chakra.Thus Sage chakraislikeanaddition to aninjasnormalchakra,notareplacement. --[[User:Ironspidermke|Ironspidermke]] ([[User talk:Ironspidermke|talk]]) 18:56, March13, 2010 (UTC)
+
Yousaythat:''Wearesupposedtochroniclewhatissaidintheseriesnottheforegoneconclusionsthatwedrawonourown.'''''Butthat'sexactlytheproblemwiththecurrentarticle.'''Callingit"ToadSageMode" and "SnakeSageMode" emphasizes the personalinterpretationoffans. Simply calling it "Jiraiya'sSageMode", "Naruto'sSageMode" and "Kabuto's Sage Mode"de-emphasizesanypersonalinterpretation '''and allows us to emphasizewhatisactuallysaidinthemanga'''.--[[User:Joolushko Tunai Fenta Hovalis|Joolushko Tunai Fenta Hovalis]] ([[User talk:Joolushko Tunai Fenta Hovalis|talk]]) 19:03, December17, 2012 (UTC)
−
::Not true. Sage chakra is a combination of regular chakra and Natural energy. Natural energy is the energy gathered from nature. <font color="#0000A0"><del>¥</del> [[User:SuperN|S<small>uper</small> N<small>ovice</small>]] [[Special:Random|↔]] [[User talk:SuperN|T<small>alk</small> <sup>2</sup> M<small>e</small>]] <del>¥</del></font> 18:53, March 13, 2010 (UTC)
* the intro is : "Sage Mode is the result of using natural energy along with a ninja's normal chakra to drastically empower all their abilities"
+
Should be: "Sage Mode is a special technique used by Sages of [[Mount Myōboku]] and [[Ryūchi Cave]] that empowers their abilities. Another legendary place known as [[Shikkotsu Forest]] also exists, but it's yet to appear along with it's inhabitants and a Sage representative"
+
Also as far as I know, Fukasaku for example isn't a ninja, so theoretically even a samurai could learn it or anyone who is skilled with chakra manipulation for that matter. My version sounds more appropriate as an intro imo.
+
The part about it's workings should be a solely separate section as there's no need to repeat some of the information twice, and Shinobi again should be changed into user/individual or something.
−
Iknowthi may be a dumb Question, but why does jiraya put extra lines on his face before summoning Fukasaku, and Shima and activating The Sage Mode
+
It'sanassumption/speculation:
+
* That Naruto/Kabuto have different power-ups while it's the very same and only technique using the same natural energy from around them, the terms "snake sage mode/toad snake mode" are basically fanon, there's not even a slight hint that there are more versions and that the benefits they grant differ.
+
* That Kabuto uses perfect/imperfect Sage Mode (we don't know even if it's most likely perfect, but since there are other factors as Orochimaru and Jugo's DNA in the play, it should be called Kabuto's Sage Mode) so stating that horns and shit are a sign of a true snake sage is double speculative. EDIT: already changed/removed partially.
+
So in short, this is how I imagine it:
+
* intro/overview in a nutshell, my proposal
+
* usage/workings/mechanics describing what it is more in detail and containing information about both it's advantages and disadvantages
+
* forms, stating what a perfect and imperfect sages are
+
* users: "Naruto in Sage Mode, Jiraiya in Sage Mode, Kabuto in Sage Mode" with a picture of each representative and a short history about their training and a summary about their "differences and workarounds"--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 03:49, December 18, 2012 (UTC)
−
:Imnotsureif im100%right, butibelieveitsbecausehehasnot yet perfected the Sagemode, as shownwhenhisforearmsandfeetbecometoadlike.--[[User:KingBarragan|ShirahaManjitomoe]]([[Usertalk:KingBarragan|talk]])00:58,January14,2010(UTC)
+
Strawmanfallacies?Friendwhenyou'rewrong, you'rewrong.SageTransformationiswhathappensto the clanmembers as aresultofabsorbingthenaturalenergy. Use context clues andfigurethatout. AllIwaspointingoutwasthatthe info was reflected in the article. And again to address your list:
+
# Both Jiraiya and Naruto's use are mentioned and categorised
+
# Incorrect. The only thing that changed Kabuto appearance was what he took from Orochimaru ergo why Kabuto looked like that when he reabsorbed his "stuff" from Kabuto. If Kabuto had turned out looking like Kevin Levin, you would have had more of an argument. Without even adding the speculation that to think you could absorb a Senju clan descendant and not so much as change hair colour.
+
# The is not one sage mode. There is simple at least three different animals that learned how to absorb, balance and use Sage Mode. Why is this point even here in the first place?
+
# There is no need to me, to mention the different uses of Sage Mode outside said person's section. All the information is represented in the article and it is neither confusing nor lost, and believe me every time something like this comes up I use third party options from people not on the site.
+
In any case I'm done with this discussion, this seems like another of those lost causes/false alarms.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 06:22, December 18, 2012 (UTC)
−
::Thoselinesare the blood contract that allow Jiraiya to summon Fukasaku and Shima into his own body. --[[User:ShounenSuki|ShounenSuki]] <sup>([[User_talk:ShounenSuki|talk]] | [[Special:Contributions/ShounenSuki|contribs]])</sup> 01:00, January 14, 2010 (UTC)
+
==seriously?==
−
==where? ==
+
WoodRelease Sage Mode/Hashirama's Sage Mode? For the 1000th time, there's only ONE Sage Mode. Why are animal/special labels even needed? It can be sorted into fewer sections.
+
The article makes it sound and appear like each is a different technique. I'm really not happy with the way it is, as you might have noticed by now (viz above convos)
+
I will take care of this myself if you don't mind, it almost has fanon content.
+
The article contains made-up terms and speculation--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 13:04, February 20, 2013 (UTC)
−
ItwascurrentlyshownthatNarutocanachievethestatofsuperperfectsagemode,whichgivehimfullpoweroverallfiveelements... whereisthisshown??? it isnot in themanga [[User:Fawcettp|Fawcettp]] ([[User talk:Fawcettp|talk]])12:06, January29, 2010 (UTC)
+
:Asfarthatcanbegathered,eachform''is''different.TheFirstdidn'tgainanyanimaltraits(frogeyesofToad,''anything''ofSnake). Thearticle(shouldn't)make it soundlike different techniques, but they are at least different styles, hence why they are in onearticleinstead of two or three.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 13:31, February20, 2013 (UTC)
TheproblemIsee, is that the labels are user-made, wood sage mode sounds... weird at least. From what we were told Sage Mode is (state a user enters after successfully combining natural energy with the other two that make up chakra and balancing it equally) the animal-like-traits that differ between users don't necessarily mean a variant. As canonical as it gets, Jiraiya got teleported in the anime to [[Mount Myōboku]] because he had "an affinity for toads" (whatever that means, perhaps his personality being reminiscent of a toad) so figure the physical changes have to do with their "affinities" rather than being a variant?
+
At least the advantages and disadvantages sections should be merged--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 13:41, February 20, 2013 (UTC)
−
Okaymymemoryisactingpoorlytoday but wheredoes it sayNaruto's numberofshadowclonesarelimitedtofivewhen using Sage Mode?<fontcolor="#0000A0"><del>¥</del> [[User:SuperN|S<small>uper</small> N<small>ovice</small>]] [[Special:Random|↔]][[User talk:SuperN|T<small>alk</small> <sup>2</sup> M<small>e</small>]] <del>¥</del></font> 05:46, February 26, 2010 (UTC)
+
:WoodSageModesoundsjustasoutlandish as anything else this manga creates, but we aren'tcalling it thatyet. The First's sagemodeisdifferentasithasnowphysical changes that resemble the other two but is mentioned for it. Anyway using the word "affinities" is still basically saying that their Sage Mode fallsunderdifferent types, except you are using a fancier word.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 13:49, February 20, 2013 (UTC)
−
:Heusedtwotohelphimcrate a Rasenshuriken,andhelefttwoatMyobokuzantohelpiminSageMode.Ifyouassumethatwasallhecouldmake, hislimitwasonly4clones, and 2ofthembeingessentialtousingSageModeincombat.--[[User:TheUltimate3|TheUltimate3]] ([[User talk:TheUltimate3|talk]]) 05:56, February 26, 2010 (UTC)
+
::Evenso...fromwhatwasgatheredsofar, all sage modes give a equallybroadrangeofcertainabilities...enhancedphysicalabilities,superiorninjutsuskills,accesstosenjutsutechniquesandaccesstocertainanimal traits.Hashiramaaside, ibelievethedistinctionbetweensnake and toadsagemodesshouldbeerased,sincebothgiveapparentlyequal benefits.[[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 13:57, February 20, 2013 (UTC)
−
:While that is true it's still not restricting him to 4 or 5 like the article says. I'm going to remove that part then since as I strolled through the manga couldn't find anything stating his restriction. <font color="#0000A0"><del>¥</del> [[User:SuperN|S<small>uper</small> N<small>ovice</small>]] [[Special:Random|↔]] [[User talk:SuperN|T<small>alk</small> <sup>2</sup> M<small>e</small>]] <del>¥</del></font> 06:05, February 26, 2010 (UTC)
−
:In chapter 434 Naruto says he can only make three clones for battle and two for gathering natural energy.--[[User:Deva 27|Deva 27]] ([[User talk:Deva 27|talk]]) 06:08, February 26, 2010 (UTC)
−
::Ah okay. Thank you Deva27. <font color="#0000A0"><del>¥</del> [[User:SuperN|S<small>uper</small> N<small>ovice</small>]] [[Special:Random|↔]] [[User talk:SuperN|T<small>alk</small> <sup>2</sup> M<small>e</small>]] <del>¥</del></font> 06:11, February 26, 2010 (UTC)
−
==Newpic==
+
Iwouldn'tsay,just to step back a relevant topic or two, Hashirama didn't have any animalistic traits. It could be that we don't know what animal it is. For all we know, it could be the Slug version (which follows the pattern of Frog (Gama) and Snake (Manda)). But that being said, even if not the slug, we still do not know what animal his markings could represent, if they do at all. At this point, we know the only other known sage modes are animals and the pattern suggests it is an animal thing, specifically (at least plot-wise) the summons. And of course "Wood Sage Mode" could be exactly what it is, but we're left with more questions with that as to how and why, and who taught him, versus an animal that can teach him (and what animal). And as for erasing things, I think that is overzealous and foolish going that far into oversimplification simply because of a bias. They are both sage modes, but they are not the same sage mode. If I remember correctly, there is a fallacy that follows that pattern. --[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 14:04, February 20, 2013 (UTC)
−
Ihate the newpicitskinndastupiditlooksso..... idon't evenhavethewordsfor that --[[User:Petar93|Petar93]]([[Usertalk:Petar93|talk]])11:39, April11, 2010(UTC)
+
Inmy opinion, the naturalenergytransformsthemaccordingtowhataffinity they have. Butthat doesn't meaneachofthemdiffer, why should we list that itgivesspeed,strength, durability,etc. to every user while it's enough to mention it once for example? If we are listing it like that, thenHashirama's should be nicknamed "Third Eye Sage Mode" or "Buddha Sage Mode" 0_o See? this is why it should be merged and differences noted with pictures alone.
+
About Hashirama, why does it have to be an animal that taught him it? Perhaps he figured how to harvest natural energy by himself, that would explain the third eye and buddha--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:07, February 20, 2013 (UTC)
−
HeytomakeNaruto'sSageModeinfinitewhydon'theusesoneofPain'sChakraReceiverssothatoneclonecanbegathering the naturalenergyandhefightswithanon-goneSageMode{{unsigned|190.32.110.53}}
+
:Your''opinion''naturalenergychangesthem by affinity. Whatwehave ''seen''isthatifaToadteachesyoutheirmethodofSageMode,yourun the riskofturningintoagiantfrog,asdidthePreta Path did when it absorbed Naruto's senjutsu chakra.
+
:We don't know what method Hashirama learned Sage Mode. He could be a Wood Sage, he could be a Slug Sage, he could be a Hashirama Sage. That's why it's mentioned that why it's just mentioned that he didn't fit the others.
+
:But I personally grow weary of this discussion, as it is the ''exact'' same discussion that is directly over this one. Do what you want I'll edit it the way I feel afterwards if that will make this battle of semantics end. But know this, I ''will'' make edits afterwards.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 14:17, February 20, 2013 (UTC)
−
==DispellingGenjutsu==
+
ThanksandIagree, no worries as I don't plan on adding or removing anything (with an exception of something being mentioned more than once), only merging, cutting/pasting so it flows better.
+
EDIT: but you are right about Pain, he started turning frog as well, hopefully it will be explained in a databook.
+
About Hashirama, I removed the headline because the section was empty, feel free to make it for him--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:25, February 20, 2013 (UTC)
−
EverysinceIsawSageModeI'vebeenwonderingcouldif it coulddispellgenjutsu. It shouldtechnicallybeabletosinceexternalchakraisentering the userbutwhoknows. WithhisvictoryinhisbattleagainsttheKyuubi, the point could be moot, exceptthattheSharingan can supressitspower=_=
+
@Elv--Evenso,themodesaredifferentandwhilethere are some base similarities, each mode that we know of (Toad and Snake) have more than quit a few differences in what it givesthe user compared to theother. It'swhyIsaidthey'rebothsagemodes,butthey'renot the samesagemode.Otherwise, they wouldn't even have the animalistic distinction. Or,well,thatlastpartismyopinion,at least. But regardless, merging would harm them more than help because there's still bits of information that would have to be separated which simply cannot be merged. Not to mention there's no cause for assuming they're the same sage mode. As for Hashirama's -- it could very well be that. But, personally,Idon'tthink we can sayeitherway till we are given the information. Yet going on what we do know about other sage modes...
@Ultimate -- I think, and it is my opinion, it can all be best summed up with a quote from you, "The article (shouldn't) make it sound like different techniques, but they are at least different styles, hence why they are in one article instead of two or three" --[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 14:26, February20, 2013 (UTC)
Well,weshouldn'tassume that each variant gives different attributes as absence of evidence is not evidence of absence. If so, then there's nothing to mention in "Hashirama's Sage Mode" because all he did was summon a giant statue, that's no proof of strength, speed, durability etc. and if we do, then we should also list equal feats for Naruto and Kabuto for example, and with that reason in mind, it has to be mentioned just once for all of them. Since a headline with a picture and one line for Hashirama isn't enough, that's why I'm for "advantages" section when all of them are listed with: "Sage Mode among user grants the following enhancements to attributes that might vary slightly"
+
I kinda imagine it like the Susanoo articles with pictures at the bottom.
+
I will try to cook something and if yay then yay and if nay then nay--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:42, February 20, 2013 (UTC)
::Sounds logical to me. —[[User:ShounenSuki|ShounenSuki]] <sup>([[User_talk:ShounenSuki|talk]] | [[Special:Contributions/ShounenSuki|contribs]] | [[User:ShounenSuki#Translations|translations]])</sup> 19:12, January 6, 2011 (UTC)
−
:::Well, it's been three days, enough for anyone who wanted to oppose this to voice an opinion, and I bumped this discussion once. I'm making the change. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 18:23, January 7, 2011 (UTC)
−
::::By the way, I'm going to poke an old issue: Rasenshuriken. Should it be considered senjutsu? We know the technique is usable to some extent without Sage Mode, but it was only while in Sage Mode that he completed the technique. At the moment, it is listed as senjutsu, but I haven't added the Sade Mode as a parent technique yet precisely because it has been used without it. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 18:37, January 7, 2011 (UTC)
−
:::::Techniques like that are always annoying... —[[User:ShounenSuki|ShounenSuki]] <sup>([[User_talk:ShounenSuki|talk]] | [[Special:Contributions/ShounenSuki|contribs]] | [[User:ShounenSuki#Translations|translations]])</sup> 18:55, January 7, 2011 (UTC)
−
==Homage? ==
+
Anyexamples?--[[User:Elveonora|Elveonora]]([[User talk:Elveonora|talk]]) 15:20, February 20, 2013 (UTC)
−
Itscurious,i waswatching a dragonballepisode, whenGokuandVegetatransformintoSSJ4, inoticedtheredcolorationaroundtheeyes and ithoughtabout the admirationkishimotohastoakiratoriyama,couldthisbelikeahomageortributeto that byaddingthecolorationtothefull sage mode eyes? {{unsigned|ToonLiger}}
+
:Iseriouslydon'tsee a reasonformultiple sage modes either. Other than appearance, noonehasshownabilitiesthatare different from each other. Also, animaltraitsonlyappearonimperfectsages.Otherwise its just pigmentation and theeyesof the animal.(Hashirama'seyesdidchange.Idon'tseewhypeoplethinkhedoesn'thavean animal.) People say that Kabutosaidhehaddifferentabilitiesthan toad sage mode.Like what? Perceptive abilities? Same thing as Naruto's chakra sensing ability. He totally sensed Sasuke's arrow coming after him. And Sasuke and Itachi when he was blind. Snake eyelid's? Jiraiya proved that one can gain traits of one's animal by unbalancing the natural energy. There's nothing majorly different from any of the sage modes. The general abilities of each should be listed in one section, instead of duplicated like it is. [[User:MangekyoSasuke|MangekyoSasuke]] ([[User talk:MangekyoSasuke|talk]]) 17:34, February 20, 2013 (UTC)
"applauds"also Kabuto's messedupjawandsnakeeyesaren'tsagemodestuff, he had these from Oro'sDNA--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 17:59, February20, 2013 (UTC)
+
:Orochimaru himself never displayed any of those. Only thing mouth related I recall Orochimaru doing was puking himself anew and healed. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 23:20, February 20, 2013 (UTC)
+
::I believe that everyone by now knows that there is only one Sage Mode taught/learnt differently by several other animals/people. With that in mind, this is how the wikia has chosen to represent the information so that all of it is not one giant section. I also do not think we should rush to conclude where Hashirama learned Sage Mode, nor do I believe that his Sage Mode is wood related. They are nothing more than headings based on necessity.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 23:27, February 20, 2013 (UTC)
−
==othersagemodes==
+
:::I'mgoingtohaveto side with Elveonora on this one. The current structure/sectioning of this article is just.... ew, and it seems to make assumptions it shouldn't, case and point: "Senju Sage Mode". O_o For one, ALL that Sage Mode is, is balancing [[Natural energy]] with the ninja's Spiritual and Physical energy. That's it. Natural energy doesn't come in different flavours. Kabuto's different appearance could easily be explained by the fact that he took on the DNA of many individuals, most notably Orochimaru, hence the appearance. Also, we don't actually know if Hashirama mastered Sage Mode, though I suppose that's a ''somewhat'' reasonable assumption, though if it were up to me we'd hold off on that. Also, Hashi's Senjustu section (in his article) has fluff. *goes to fix* [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 13:57, February 21, 2013 (UTC)
+
::::Again, it is established that there is one Sage Mode that is used differently based on how people learn it. These titles are nothing more than a means to differentiate the abilities that persons learn and display. Maybe if the article were to actually mention this, it would be better? You could not expect someone that learned from frog to be using White Rage Technique or a Snake to use Frog Kata, hence everything is not lumped together, but all are in their respective sections. While I am not too certain about the title "Senju Sage Mode" --[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 14:56, February 21, 2013 (UTC)
−
doallanimalsthatcanhavacontracthav a sageoris it justfrogslikecouldtherebeasnake/hawk/dog/slugsageandifnoty{{Unsigned|99.90.132.45}}
+
EvenwithyoureditsCerez,themainproblemstill stays. For example, Frog Kata isn't a partofSage Mode, it'sasenjutsutechniquetaughtbytoads.Thenthere's this perception/sensorything,viztranslationsayssensoryin Kabuto's case as well, confirmed by Seelentau.
Thejawpart, Orochimaru has it as well, just look at his cheeks and the brille part, what does it have to do with Sage Mode? Figure that a man with snake dna has snake eyes even without it? The article is still structured in a way that states that each "animal version" or what **** gives different powers. AllSageMode users have the same enhancements, beit them dog, cat,boar or whatever animal.
+
Only unique techniques like Frog Kata or long tongue, turn rock alive or annoying genjutsu sound differ--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 18:10, February 21, 2013 (UTC)
+
:I can't agree with that. I've never seen Orochimaru open his mouth like that nor use brille to cover his eyes. People at times seem to forget that Orochimaru is a human being, not a snake. Yes he has a snake form which his body has been "reduced" to but for all intents an purposes, he is a human that uses snake-motif techniques. This is why he was not revived as a snake but with a human body. Kabuto's transformation could easily be akin to Jiraiya purposefully growing frog legs/arms to use in his battle against Pain. There is a general section in the article which mentions what Sage Mode grants a user, though we don't even know that to be true except for the bolstering of techniques. In my opinion, Sage Mode does grant the same basic abilities which is mentioned in the article, but we can't just ignore the person/mode specific abilities. How else would we be able to account for them? --[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 18:20, February 21, 2013 (UTC)
−
==SagemodewithoutToadElders==
+
Idon'tshareyoursentiments,heturned his body into a giant white snake, even tho he can change back at will, his human form is only a leftover of his humanity, for what I would say, he has more snake genes than human genes. Kabuto grew scales when he injected himself, not dark hair. And just because we haven't seen Oro doing creepy jaw thing and protect eyes against visual genjutsu thingy doesn't mean he can't.
+
He can extend any part of his body with [[Soft Physique Modification]]. About Kabuto, even if he changed himself further into a snake purposely, it's not a part of Sage Mode, just like Jiraiya's toad features aren't, turning animal happens when the natural energy isn't completely balanced. About specific abilities, there's link to list of senjutsu techniques down there, it can be expanded with them being actually listed--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 19:05, February 21, 2013 (UTC)
:Also, Kabuto opened his jaws that wide when he entered slitering snake mode. And again when he swallowed Yamato. [[User:MangekyoSasuke|MangekyoSasuke]] ([[User talk:MangekyoSasuke|talk]]) 20:15, February 21, 2013 (UTC)
−
theabovepageshowshim in sagemodewithout the elders.
+
Prettymuch,there'snoexclusive things in betweenthemas they all are one and the same. That's like saying shadow clone performed by toad differs from one done by a human--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 20:21, February 21, 2013 (UTC)
The problem with the current version is that it implies Kabuto can't do certain things that Naruto and Jiraiya could, rather than leaving it ambiguous. Kabuto didn't actually show whether he can sense chakra like Naruto, for example, but the article's current layout would imply to a reader that he can't. As for unique traits used by Kabuto, there was just White Rage and Muki Tensei, which were specific examples of senjutsu, and possibly his snake brille, but we can't say for sure whether it was from Sage Mode or Orochimaru's white snake DNA. Kabuto was even more snake-like than Orochimaru after all, since he developed scales rather than just pale skin.--[[User:BeyondRed|BeyondRed]] ([[User talk:BeyondRed|talk]]) 22:03, February 21, 2013 (UTC)
−
and here he compares himself as a "tadpole" and not that he can't do it at all on his own. He just sucks real bad when doing it alone.[[User:NoJutsu|NoJutsu]] ([[User talk:NoJutsu|talk]]) 17:57, September 19, 2011 (UTC)
−
Okay, I can see this is going to end up becoming an edit war if things continue like this. Jiraya cannot keep up Sage Mode without Fukasaku and Shima using their [[Sage Art: Amphibian Technique|Amphibian Technique]]. He can enter it alone, butonlyforashorttime;that was the whole point behind Jiraya summoning them: so that he could move around and stillbereceivingsenjutsu chakra. Please quit adding it. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 20:42, September19, 2011 (UTC)
+
He did, hedodgedSasuke'sarrowwithoutlooking and commentedonsensoryability.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 23:02, February21, 2013 (UTC)
−
I'msureofyouread the article,you'drealisethattherisk of standing still to re-enterSageModeconstantlyonabattlefieldisahugerisk. This is thewholepoint of the Sage Art:AmphibianTechnique.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:HyūgaSymbol.svg|20px]] 21:12, September19, 2011 (UTC)
+
:I tookthattobe the same asNaruto'senhancedperceptivenessallowinghim to dodgetheThirdRaikage'sattackinSageMode,butbothmightbeapplications of the generalsensoryability.--[[User:BeyondRed|BeyondRed]] ([[Usertalk:BeyondRed|talk]])00:01, February22, 2013 (UTC)
−
Ah, I understandwhatNoJutsumeant, I think.It's beenfixednow,Ithink.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 21:27, September19, 2011 (UTC)
+
::All I'mgoingtosayatthis point is, I willnot have information lost, because it's stupidtoloseinformation for noreason.--[[User:TheUltimate3|'''TheUltimate3''']][[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 00:13, February22, 2013 (UTC)
−
I'm stillunsurewhathemeant,butwhatever,thearticlelooksbetterthanbeforeso it's all good.:-)[[User:Skitts|Skitts]]([[Usertalk:Skitts|talk]])21:51,September19,2011(UTC)
+
To this discussion, i'm forcedtoagreethatthereisonlyoneSageMode.Asfarasi see it all usersofithavedisplayedequalbenefitsallaround.Let's see:
+
* Enhanced physical and perceptive abilities - Check
+
* Increased potency of all ninjutsu, genjutsu and taijutsu - Check
+
* Gained sensory capabilities - Check
+
* Partial animal shape-shifting abilities - Check
−
==Speedentering the Mode==
+
Asforthe dissadvantages we already known those, since it's universal...to me the only difference lies in which sage trains you, but the general abilities all appear to be the same...[[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 21:44, February 22, 2013(UTC)
−
Isee there wereafeweditsrecentlyaboutthespeedinwhichNaruto has entered Sage Mode.Didn'tNarutoenteritveryquicklybeforehemetKonan and Nagato at the outskirts of Konoha?Hewasn't inSageModewhenhemetShikakuandInoichi,butheentereditveryfastoncehegotto the tree.OramI remembering in the mangasomethingthatonlyhappenedintheanime? [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]]23:19, January11, 2012 (UTC)
+
Ofcourse there'sonlyoneSenninMode.Whywouldtherebemore?TheSennin Mode isthestateofhavingnaturalenergyinyourbody,youdon't evenneedtohavecontroloverit(likeJiraiya).ButIstillthinkweshoulddifferentiatethedifferentteachers of the SenninModeandhow the userlooksdifferentdependingonwhotrainedhim. [[User:Seelentau|Seelentau 愛]]<sup>[[User Talk:Seelentau|議]]</sup>21:51, February22, 2013 (UTC)
−
:Wedon'tseewhenheentered Sage Mode in the manga. UnlessI'mmistaken the animeonlyshowedhimfinishingenteringSageMode, wedidn'tactuallyseehow long it took.--'''''[[User talk:Deva 27|Deva]] [[Special:Contributions/Deva27|27]]'''''23:38, January11, 2012 (UTC)
+
:Butthewholeproblem of this discussion is that...by the way the article is constructed...outright states,thateach Sage Mode (Toad, Snake, Slug?) is it own, with different gains and losses, while the three known examples (Jiraiya, Naruto, Kabuto) have displayed near identical benefits. Theonlyactual difference seems to rely on the influenceoftheanimalsagethattrainsthe user, butinpractical,combatterms it maybe all the same.[[User:Darksusanoo|Darksusanoo]] ([[Usertalk:Darksusanoo|talk]])22:01, February22, 2013 (UTC)
−
::When he went to Nagato we only see him arrive at the tree [last pages of chapter 443]. I don't think there was ever an instance where it took long though outside of when Preta was absorbing his chakra.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 00:22, January 12, 2012 (UTC)
−
:::Originally he took a while to enter the mode-such as during his battle with pain when he's caught by the Preta Path, it takes him some time to gather the energy which turns him to stone. By the time of the Shinobi war, he can enter the mode so quickly that the guards watching over him and Bee couldn't react at all; the battle with madara, he was quick enough to enter the mode and throw the rasenshuriken before madara could do massive amounts of damage to the division. Then there's the clone inside Son Gokú- considering on the outside the Ape was dealing with Tobi's chakra chains, an attacking Naruto and the eight tails going near full force at it, the clone on the inside wouldn't have had much a still moment at all-he'd have had to enter the mode extremely quickly. [[User:Scorn53|Scorn53]]
−
::::Like I said before the [[Preta Path]] ability is to absorb ninjutsu (chakra). That cannot be used as a benchmark.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 01:07, January 12, 2012 (UTC)
−
== Sage mode clones? ==
+
Well, who is to say they are even actually the same? All can be sage modes, but not be the same thing, as I mentioned earlier. We have plenty of cases of "All A are B but not all B are A", etc. It's one of the principles of logic, and of course has a fallacy to go along with it. It also doesn't make sense that if all one has to do is enter the singular and nonspecific sage mode is acquire and balance natural energy where there is even a difference between the transformation between the types of Sage Modes we know of. What causes Naruto and Jiraiya to change into their respective sage mode;what of Kabuto? The way they may acquire it is the same, in theory. But is it? All they're doing is gathering and balancing natural energy, so, reiterating -- why the change in their physiology of any form, whether markings or other? Maybe it's plot-no-jutsu but then if so, why are we coming to this point in the discussion of whether to merge or not? That in and of itself is speculation. What tells us that the Sage Mode is only one thing for each person. And what logic can you use to support that, while also explaining the differences in the physiology of the users? --[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 23:57, February 22, 2013 (UTC)
−
HowmanyclonescanNarutomake in Sagemode?peoplesay5butwhenhefoughtthekyuubihemadelot's andifthisisbecause of thelocationtheninthatlocation the rulesshouldstillapplyunlesshecoulddo anything he wanted to inthatlocation.{{unsigned|89.240.176.223}}
+
Readabovetheaffinitything, that is a possible explanation. Why they do turn animal is completely irrelevant tho, in termsofwhatthistechniquedoes,itshouldbelogicallyevenamongall.There's onlyonekindof natural energy, Abit of speculation,butlookatJugoand the Ten-Tails,theformer'sbodycanshapeshiftintomultiple forms, possibly anything he wishes and his mentality is unstable. Ten-Tails is a physical manifestation of natural energy, it appears to besentientonly on a primitive level at best and it transforms as well, suggesting it's dependent on thoughts, feelings, personality etc. Eyes are the mirror of the soul after all ;D
−
:NarutostatedthathecouldonlymakethreecloneswhileonthebattlefieldwhileinSageMode without disrupting the othertwo he had absorbing natural energy. That fight happened in his mindand to be honest, alotofwhatwasdoneinthereprobablycouldn'tbeappliedtoareal-world fight.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:HyūgaSymbol.svg|20px]] 15:55, January25, 2012 (UTC)
+
CurseMarkusersforexample,Sasukepersonifiedhimselfwithahawkandhisformhadwingsand the markingon his nosecould be a beak, healsomanagedtoreplacehislostwingwithsnakesduringhisfightagainstDeidara--[[User:Elveonora|Elveonora]] ([[Usertalk:Elveonora|talk]])00:48, February23, 2013 (UTC)
−
== Snake Sage Mode ==
+
It doesn't explain it, however, as there are places and people (Sages/animals) that teach it. And everything we know up until now, excluding Hashirama (which I feel, speculatory, is Slug), is that you learn it at a special place from special animal sages, and if we postulate that the 3rd place Kabuto mentioned is for the Slug sage, it only makes the case that much stronger. Why would an affinity matter? Why would the animal teachers matter, if its all the same thing? And turning into an animal isn't irrelevant, either, we were first introduced to "You turn into a Frog statue if you fail.", to what would be highly likely: "You ''may'' turn into a Snake (or dragon) statue if you fail." But it, like I stated above, comes down to what? Kabuto could've potentially learned from the frogs as much as Naruto could the White Snake Sage. But you are right in that "in terms of what this technique does" is create something, but that comes from senjutsu and not Sage Mode, I would postulate. Though I don't know how to clarify that as of this moment. Presently, I just do not see enough, or any, evidence to suggest they are one and the same, while also providing evidence to provide an example of why there are differences.
−
IfthesnakeSageModeendsupbeingmoredistinctsomehow(even though theyseemly use the same energy source...),arewegoingtosplititoffintoanotherarticle, orsimplyleaveithere? [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 16:27, March21, 2012 (UTC)
I for one, don't think its some sort of affinity. I think sages learn how to absorb natural energy from the specific animal they're learning it from. Natural energy comes from everything, so its logical to think that there are different types of it. It would not only explain why preta turned into a toad, but also why Jugo can change his body into multiple forms, and the cursed seals' resemblance to multiple animals. My logic behind it is that the only differences between sage modes are the ability to transform parts of the body into the animal learned from when the natural energy is unbalanced, as proven in Jiraiya's, and possibly Kabuto's case. Because other than that, they have yet to show any difference from each other. And the way I see it, that info can easily be placed separately while the shared abilities are merged into one section. [[User:MangekyoSasuke|MangekyoSasuke]] ([[User talk:MangekyoSasuke|talk]]) 07:29, February 23,2013(UTC)
−
--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 16:39, March 21, 2012 (UTC)
That would make sense, in case if only Naruto hadn't turnedtoadwhenabsorbingitoutsideof [[Mount Myōboku]] itdoeshappeneverywhereeven in places where no toads are nearby. Also assuming there are multiple forms of natural energy isn't viable since we weren't told assuch, quitethe opposite, it'sin the earth, atmosphere, all around. When Jugo changed his arm during the Oro revival scene, he called it his original Sage Transformation, meaning that's what it looks like when he is in control, but when he goes berserk, the forms are random. That's why I think natural energy changes them accordingly to their mental state. Kabuto turned "dragon" not because he surpassed Orochimaru, but because he only thought he did, thinking himself superior.
+
I don't think it matters who taught it whom, but if you associate with them.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:58, February 23, 2013 (UTC)
−
==Teachers==
+
:And everything you just mentioned is speculation and what you ''believe'' happened when compared to what we actually ''know''. Naruto learned Sage Mode from toads, hence toad if you fail, toad if you absorb senjutsu chakra and can't control it, toad like if can't balance it correctly. Kabuto learned Sage Mode from snakes, thus, snake.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 15:46, February 23, 2013 (UTC)
−
Is there any particular reason that the [[White Snake Sage]] and the [[Great Toad Sage]] aren't added to this list? Teaching senjutsu seems good enough to be listed as a user. — [[User talk:Simant|S<small>im</small>A<small>nt</small>]] 04:54, March 22, 2012 (UTC)
−
:When was it said that the Great Toad Sage taught Senjutsu? And Kabuto could have been taught Senjutsu the same way Kakashi taught Naruto in his Wind Release training: simply instructing him even though he couldn't perform the task himself. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 12:22, March 22, 2012 (UTC)
−
:: I'd say that being able to use senjutsu seems to be a essential part of teaching it, since Fukasaku taught Naruto instead of gamabunta teaching him.--[[User:TricksterKing|TricksterKing]] ([[User talk:TricksterKing|talk]]) 13:07, March 22, 2012 (UTC)
−
:::From the senjutsu article: "A person who is able to use senjutsu is called a sage (仙人, sennin)" — [[User talk:Simant|S<small>im</small>A<small>nt</small>]] 19:28, March 22, 2012 (UTC)
−
::::I wouldn't have a problem with them being added as more than likely they're able to use it. But there is also the fact that they could know it in theory and not practical. It also says a Sage is a wise, holy etc person.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 19:33, March 22, 2012 (UTC)
−
== Kabuto Sage Mode ==
+
::I'm with Ultimate here. This entire argument is ridiculous. We have the three different variations of [[Susanoo]], based on user, on its page, despite the fact that it is the same technique. All of the differences of each unique Susanoo is already listed on the character's page itself. The same should happen here. The different variations of Sage Mode should be mentioned. If anything, it should be done like Susanno was (i.e., "Naruto Uzumaki's Version", "Jiraiya's Version", "Kabuto Yakushi's Version", and "Hashirama Senju's Version") listing the things specific to each Sage Mode.Regardless of whether or not Sage Mode is the same across the board (and clearly it is not), each user has used it very differently from each other, thus far, and therefore, I think it would be a loss of information to take the sections out. And Elve, enough speculation. Use the cold-hard facts, as in what we have physically seen and heard from the anime/manga as facts, not "what-ifs". ~ '''''[[User:Ten Tailed Fox|Ten Tailed Fox]]''''' [[File:Yamagakure Symbol.svg|14px|link=User talk:Ten Tailed Fox]] 16:27, February 23, 2013 (UTC)
−
CoulditbepossiblethatKabuto's sagemodecharacteristicsaredifferentbecause of hisweirdsnakemutations?Perhapsanormalperson with SnakeSagemodewouldhave less characteristics, likejust a darksclerawithdarkenedskin under the eyes (similiartohowNaruto'ssagemodelooks like).
+
Susanooisadifferentcase,it's aphysicalmanifestationofaMS user's chakra, of courseitwilldifferbetweenusers.Iagree with the"xuserversion"thing, wouldbe better, a nicecompromiseifitbe--[[User:Elveonora|Elveonora]] ([[Usertalk:Elveonora|talk]])16:52,February23,2013(UTC)
−
ButIsupposethis is speculation, hmm... Justthought it wouldbeworthmentioning:d[[User:Derigar|Derigar]]([[Usertalk:Derigar|talk]])22:26, March22, 2012(UTC)
+
::@Ultimate--Correct. We know the process of absorbing natural energy is the same for all. We are not really told how Sage Mode is activated, but it is implied that it is simply by absorbing natural energy in large amounts; Naruto simply meditates and it occurs. So there's no differentiating factor for the different sage modes, and yet there are differences between them. Whilethere may be similarities in the advantages it provides,thatisduetothebodyflowingand being in harmony with natural energy -- a side product, if you will, instead of Sage Mode itself . ''Note: Sounds like speculation, couldbe speculation but I think based on Juugo and the other things we know about natural energy and sages it isn't speculation.'' But like I pointed out about Juugo and his clan, they can transform -- Juugo transforming into different things when he wants -- and their bodies and more are boosted with natural energy. The end product is "Sage Transformation", a lot like Sage Mode. The latter, however, utilizing senjutsu chakra at the end.
−
==PerfectSnakeSageMode?Seriously?==
+
::@Elv--Asfor Kabuto being a Dragon versus a snake, I am going to assume (speculation)it is because the idea that dragons are above snakes in a lot of Asian cultures, sometimes being the same animal but the dragon being more heavenly or godly (more powerful/advanced, in other words). Or, at least, that is what I understood when I first read the chapter, otherwise I do not think it would've even been mentioned by Kish. Kabuto may not even be perfect, based on his anatomy. Yes, some of it is due to the experiments and other things, but it also reflects the imperfect changes we've seen in Jiraiya.
−
ifyouread chapter 579 again on page 17, kabutoclearly says 'evenhecouldntbecomeatruesageintheendjustlikeme!'implyingthatitsnotperfectandtomake sure readers understood kishimoto made sasuke even say 'he's the sameasorochimaru.an'''IMPERFECT'''snake.'probsofansunderstand that this is not the perfectversionlikenarutohaswithfrogsagemode... Alsowhennarutowastrainingtobecomeasageirememberfukasakusayingsomethinglike to actuallyachieveperfectsagemodethereshouldbenotracesoftransformationotherthan the pigments of the eyes getting darker (chapter 418, page 8),clearlykabutohas the features of a snake/dragononhisbodyjustlike jiraiya had frog/toad features when he went into sage mode, soclearlykabutossagemodeis IMPERFECT, pleasesort the informationonthe sage mode page out as its not accurate.{{unsigned|2.220.230.81}}
+
::Atanyrate, Tl;DRversion:There'snoevidencetosuggestSageModeisonlysingularthing,withvastphysicaldifferencesbetweenhowthesenjutsureactswithin the usersandothers(PretaPathchanging). Rather,itissenjutsu that provides the similarbonuses,corroboratedbyJuugoanddialoguefromothers. Ipostulatefornowthereare3known,different,SageModesasalltheevidence points to that.Thatbeingsaid(andyes,itisturningouttobelongagain...) the page couldreflectthatin a waythatcombinestheabilitybonuses, butstillmakessuretodifferentiatebetween the differentmodes.
−
:Yes. He is saying that in the end Orochimaru couldn't become a perfect Sage like he had done. That was the whole point of saying "me no snake, me dragon" Also, I'm not sure why you think what rings true for a toad sage is the same for a snake sage. When and if more information is available and corrections are required they shall be made.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 23:45, March 22, 2012 (UTC)
−
then please explain what its meant by when sasuke said 'he's the same as orochimaru. an '''IMPERFECT''' snake.', sasuke saying that and kabuto not correcting him just shows that he has not completed his sage training fully
−
{{unsigned|2.220.230.81}}
−
Pleasesignyourpostwith4"~".
+
Edit:''Note:@TenTailed,Itypedall of this before I saw yours''--[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 16:58, February 23, 2013 (UTC)
−
Also, Cerezalreadymentionedwhy. [[User:Derigar|Derigar]] ([[User talk:Derigar|talk]]) 21:22, March 23, 2012 (UTC)
+
@98xxxsomething, bingo,that'sexactlywhat the topic was about before it has gone offtopic thanks to me included (just wanted to throw around some theories and opinions) it's pointless to have listed "increased strength, speed, stamina, durability etc." for every of them since it's even, that's basically having the same thing there multiple times. Also naming of each "variant" should be changed from animal to user's name as Fox suggested and I would agree with. That way, it's a neutral approach that doesn't necessarily speculate that each of them differs nor that they don't, meaning that the differences vary and depend on it's user rather than it being a different "version" of Sage Mode eachtime--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 17:07, February 23, 2013 (UTC)
Thatdoesseemlikeanappropriatecompromise...listingthegeneralbenefitsunderonebanner,whileshowcasing each individual mode showed by it's user, rather than repeating them over and over. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 17:21, February23, 2013 (UTC)
−
:::Uh yeah why did Orochimaru get taken off the list? Like the above poster said, their situation pretty much exactly mirrors Naruto's and Jiraiya's. [[Special:Contributions/68.35.56.104|68.35.56.104]] ([[User talk:68.35.56.104|talk]]) 04:18, March 25, 2012 (UTC)
−
Kabuto said Orochimaru's hostbodyat the timecouldn'tabsorbnaturalenergydidn'the?Sohecouldn'tbecome a sage. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 05:27, March25, 2012 (UTC)
+
Here's something some of you are forgetting: Sage Mode improves the user's natural abilities. For example, Fukusaku thought to himself that Naruto's healing rate had been vastly improved because of both Kurama and Natural energy. Kabuto becoming a 'Dragon' was, as we know, because of the whole dragons being (basically) super snakes, referring to him surpassing Orochimaru. Again, Sage Mode is just balancing Nature's energywiththe energies within the medium,imrpoving their own '''innate''' abilities.KabutodevelopedNOnewsnake-relatedabilitiesas a result of Sage Mode. The jaw thing was done sans-Sage Mode to swallow up Yamato on the Island Turtle. He gained the sensor-type chakra detection, as per dodging Susanoo's arrow. Everthing I recall Kabuto doing non-jutsu-wise was simply improved snake-esque abilities. Sage Mode appears to be more related to Toads anyways, considering failing to maintain adequate control over the energy results inbecoming a petrified toad. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]])18:09, February23, 2013 (UTC)
+
:If that were true, neither the Ryuchi Cave, nor the White Snake Sage would exist...from where it stands the animal traits a Sage Mode user gains are dependant on which animal sage trains them, but that's about it. The benefits they gain have so far been mostly the same. As for the sage techniques themselves, it's obvious each sage has learned/developed their own techniques from sage mode. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 18:23, February 23, 2013 (UTC)
+
::But that's just it, Kabuto was ''already'' snake-y prior to Sage Mode, so I don't really see what snake traits he acquired that he didn't already have, from scales to belly tail (lool). All that happened was he got.... horny. :) [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 18:35, February 23, 2013 (UTC)
+
:::Lol, funny...The snake brille, the way he cracked open his jaw to catch sasuke...when he did that to Yamato, he had to change to a completely new form...when Jiraiya faced Nagato, he changed the shape of his hands and feet into toad ones for increased mobility...he had snake anatomy before, but that doesn't mean he couldn't gain further access to it through Sage mode. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 18:57, February 23, 2013 (UTC)
+
::::I think we're talking past each other. :) I'm agreeing with that last part you said. Sage Mode enhances the user's innate abilities as well (Fukusaku said it increased Naruto's healing rate, for ex.), and Kabuto already basically was a snake, so no surprise in that department. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 19:19, February 23, 2013 (UTC)
−
::Apologies, it'swordedabitdifferentlyacrosstheavailabletranslations. While it seemsthathewasabletoreachRyuuchidouas Kabuto did, it'snotclearatthispointwhetherornothewascapableofdrawinginnaturalenergy. [[User:SaiST|SaiST]] ([[User talk:SaiST|talk]]) 13:44, March25, 2012 (UTC)
::: Yeah, I suppose we'll have to wait for more info from Kabuto hopefully. None of the translations I read mentioned natural energy at all, most were worded like Orochimaru gained the abilities of sage mode but couldnt completely utilize them because of his body, which I took to mean imperfect sage mode like Jiraiya. But we only have a couple of panels of info for now so hopefully more comes in the next few chapters. [[Special:Contributions/68.35.56.104|68.35.56.104]] ([[User talk:68.35.56.104|talk]]) 03:50, March 26, 2012 (UTC)
−
==Notconfirmed==
+
Thebenefitsarethe same, but I want to make sure it's understood that it isn't sage mode in and of itself, but senjutsu that provides the bonuses to enhanced physiology, etc. As well as Toad Sage and Snake Sage are different Sage Modes in how they work, normal senjutsu bonuses aside (that Sage Mode doesnt exist by itself). While Kabuto may exhibit some more Orochimaru characteristics, his form differs from a normal person while in Snake Sage Mode. At some point Orochimaru may have altered himself to fit the Snake Sage persona, as well, if we go by why he wants a new body to use sage mode. The horns may be the sign of a True/perfect Snake Sage, going on what Kabuto says. And while it may be speculation, I do think we can agree that a Snake Sage wouldn't be able to perform any Toad Sage abilities, and vice versa. Kabuto also, during Hakugeki, is able to use his Snake Sage abilities (cornea; not including the modifications from Suigetsu and etc) to allow him to function while Sasuke and Itachi are rendered useless. There are many things to remember to distinguish and separate, and I just would not like them to be lost and for the page to reflect that there's only one actual mode when it's not the case --[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 21:51, February 23, 2013 (UTC)
−
Under the section"Usage" is written:
+
Bruh, Just leave it the wayit is, it's more understandable. For all I care, Naruto and Jiraiya learned Sage Mode from the toads and so therefore has the support (summoning) and trait-like from the toads and that Kabuto and maybe Oro learned Sage Mode from the Snakes and therefore has the support and also trait-like that of a Snake .....{{unsigned|75.170.19.115}}
−
"The Shikkotsu Forest is the third place to have knowledge on senjutsu." Even if is very likely, until now this is only an assumption (Kabuto only says that this place is is equally as famous as Mount Myōboku and Shikkotsu Forest); so I think that this line should be deleted. --[[User:JK88|JK88]] ([[User talk:JK88|talk]]) 20:58, March 26, 2012 (UTC)
−
:Done.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 22:04, March 26, 2012 (UTC)
−
==SnakeyAppendages==
+
@'''98.101.165.89'''Erm,nuuu.For one, we've never seen a 'regular person in snake Sage Mode', so don't know where you got that from. So far, the only potentially valid variation brought up in support of a distinguished Sage Mode has really been Kabuto's cornea, and even that has been decently shown to be explainable given what else we know about Sage Mode enhancing the user's abilities. Everything else so far has been mere mention of different techniques, which is a non-issue considering there are innumerable ways to manipulate one's chakra to do different things, even within the same class/sub-class of techniques (ex: [[Wind Release: Rasengan]] & [[Wind Release: Rasenshuriken]]). So basically my suggestions are the following:
−
On [http://www.mangareader.net/naruto/580/2thispage]itlookslikethereis a snakegrowingout of Kabuto'sstomach.Shouldthis be consideredpart of hishermitmode? [[Special:Contributions/174.252.185.254|174.252.185.254]] ([[User talk:174.252.185.254|talk]]) 23:50, March29, 2012 (UTC)
+
:Group everthing into 2 sections, "Imperfect Sage Mode", and "Sage Mode". The former's contents are obvious. Thelatterhowevershouldinitiallygoover the know benefits of Sage Mode, increased jutsu strength and bodily prowess (speed, sensory perception, etc), Chakra-sensing, Amplified innate abilities, etc. I think a good compromise would be to indicate the somewhat uncertainty that someherehave of therebeing possibly distinct SM flavours. But really, that slight uncertainty shouldn't be dictatingthe structure of thearticle,and reduce the large amount of redundancy currently in it. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 05:43, February27, 2013 (UTC)
−
:He already had a snake appendage without being is Sage Mode. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 02:04, March 30, 2012 (UTC)
−
==Image==
+
@Skitts--Thankfully you misunderstood what I meant by normal/regular person. I meant just that -- a normal or regular person -- not a sage. And there are plenty of variations, moreso on the speculative side however, that are either outright stated or could be inferred. Though I do not wish to go back into redundant topics; and to ignore what has been established, the different modes, despite the fact there's no support for the concept or idea of one singular, global sage mode, nor is it even suggested in Naruto, seems foolhardy, IMHO. Until there's more information available regarding the validity of those claims (Sage Mode being just Sage Mode and there's absolutely no differences between the types (which logically doesn't even make sense given the fact they exist)), or any other ideas regarding it: I think the article should continue as it is with slight alterations to clean it up and make it more concise, less redundant; not to the extent of changing the meanings of things, however. --[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 20:09, February 27, 2013 (UTC)
+
:But I've seen nothing inferring the existence of different kinds of Sage Mode. You don't assume a difference without a stated reason/heavily implied distinction in the series. Based on what both Fukasaku and Kabuto have said, Sage Mode = Balancing natural energy with your own to increase overall prowess, QED, nothing else. Therefore that's what it is. Technique sub-classes (i.e "White Rage") are a non-issue. If you and I are going to continue, let's do it via our Talk pages (it'd be nice if you registered ;-D) [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 20:26, February 27, 2013 (UTC)
−
Is there anyparticularreasonwhywehaveJiraiya's imperfect Sage Mode as the imageotherthan it lookscool?:pIdon'trecalluseverhaving the imperfect/unfinishedversion of atechnique as anarticle'smainimage. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 04:11, March30, 2012 (UTC)
+
::Off-topic - I used to be registered but I cannot remember the name I used, and cannot even find it within my emails. I could do it again, I suppose, after this (because I feel it needs to be public). On-topic: Yes, Sage Mode is balancing natural energy to form senjutsu within the body to activate Sage Mode. Sage Mode is more of a concept or theory, the way I try to describe it. Practically, there canbethousandsofSageModes,but there's not one global Sage Mode which encompasses the others,sansanimalistic difference. That is why it isimportanttodistinguishthatitisToadSage Mode, Snake Sage Mode, etc. Regardless if the process is the same, the results are different, for whatever reason. Toad Sages come out to be the same, Snake Sages are the same, etc. So until there's more information that supports a hypothesis that each sage mode is identical and irrelevant in relation to animals/physiological changes (which, again, is contradictory since there are varied differencesregardless of techniques(though it still can apply in some cases), then it (the page) should reflect as itisnow,with the alterations of removing the redundancy found within. --[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 01:40, February28, 2013 (UTC)
−
Sage Mode is Sage Mode,anditisthefirsttimewesee it.Thereisalso the factthatitshowshowitwouldbenormallyused(FukasakuandShimaonhisshoulder).--'''''[[User talk:Deva 27|Deva]] [[Special:Contributions/Deva27|27]]'''''04:15, March30, 2012 (UTC)
+
:(My Last response unless someone different pipes up) Again, you're assuming a distinction ithout a stated difference in the series, Heck, it was never said by Kabuto that he had mastered 'Snake Sage Mode',simply that he mastered Sage Mode.Kabutoalreadyhadhissnaketraitspriorto Sage Mode, so you can't claim it toaccountfor the wholeshebangthere.AndasIsaidearlier,failingtomaintaincontroloverNaturalEnergy itself results in a '''Toad''' transformation, nothing else, a la Jiraiya. Since no actual distinction between practicioners has even been implied (only different teachers) it shouldn't be implied in the article methinks. [[User:Skitts|Skitts]] ([[Usertalk:Skitts|talk]])03:38, February28, 2013 (UTC)
−
:Hm, I'm not so sure. We don't always use image of the techniques when they were first used and we definitely don't use ones of the incomplete version of the technique (not for Rasengan, Susanoo, or any other that comes to mind.) The Amphibian technique isn't how it would normally be used. That was just a way for them to overcome the shortcomings of the technique. For example, just because Oodama Rasengan somewhat overcomes the base Rasengans difficulty in hitting the foe with such a small object at close range doesn't make it how it's normally used. I'm not trying to make a stink about this, I just thought it was odd. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 04:29, March 30, 2012 (UTC)
−
::Jiraiya's form wasn't incomplete, just imperfect. The same could be said of Naruto's. Fukasaku and Shima were supposed to merge with him but they can't so ''technically'' they'd both be bad representations.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 09:37, March 30, 2012 (UTC)
−
yes. Butsagemodedoesn'tmeanfusing...- It justmeanstakingnaturalenergyinperfectamount and all that - so aperfect sage mode picture would be better
+
::It was heavily implied, if not outright stated, that Kabuto achieved perfection in regards to Snake Sage Mode, going so far as to talk about the journey, about how he became more than a snake, that he became a dragon, blah blah blah. Hehadsnaketraits, but that'sirrelevanttothetopic at hand, as, for instance: his horns were more than likely not a product of his experiments. It alsohelpedtoprovethathe became a dragon, which, if we gobystandard and general Asian lore (meaning collective, non-specific), dragons are above snakes, and the horns signify that -- so no speculation or assumption. Otherwise, Kish wouldn't had drawn horns on him, or even mentioned the bit about the dragon, etc. Again, we are not discussing his pre-existing condition, but rather that which changed duringhis sage mode event. You can say it earlier, but I would highly doubt a Snake Sage in training would turn into a frog if he fails to balance the energies inside his body. That simply wouldn't make sense with the snakes, nor with the plot regarding it. I am not sure at what point there is a discourse in the understanding of any of it. And as I said earlier, the process may be the same, but the result is different, otherwise they wouldn't be a difference to even show in the body/eyes/anywhere else, blah blah blah. It is cumbersome to reiterate the same things, and I mean no offense with that. --[[User:Taynio|Taynio]] ([[User talk:Taynio|talk]]) 05:52, February 28, 2013 (UTC)
:Actually no, it means the ability to use natural energy, it was never said Sage Mode was doing it <u>perfectly</u> since what Jiraiya did was never not considered Sage Mode.--[[User talk:Cerez365|Cerez<sub>365</sub>™]][[File:Hyūga Symbol.svg|20px]] 10:31, March 30, 2012 (UTC)
−
== Sage Mode Cleanup==
+
:If it was stated/heavily implied (it wasn't) post a reference please. But really, I'm doubtful you've read the above convos, because I think I've stated everytime how to account for Kabuto. For one, he never mentioned a different Sage Mode. The mention of the journey? Okay? He just said that he ventured to Ryuchi Cave to learn Senjutsu from the Snake Sage, that said nor implied anything about a different Mode. And again, horns are easily accounted for. For the like 4th time, Sage Mode increases your own innate abilities. Naruto's healing rate was even greater in SM (chapter 415, page 14). Kabuto was snake-y prior to SM, hence entering it caused him to transcend snake to 'dragon' (clearly a simple nod to Asian folklore). And again, Natural Energy is natural energy, it recognizes no divisions based on teacher. Fukasaku plainly said that failing to keep it under some amount of control (and/or ''not'' having a large chakra supply already) would result in becoming a Toad and possibly petrifying, which we've seen happen to the Asura Path. And visual differences would seem of little use here. Heck, Jiraiya's appearance was crazy and didn't really resemble Naruto's at all. Kabuto's appearance was chiefly as it was because of his DNA integration, mostly Orochimaru's. We have no clue what a non-DNA hoarder would look like if it is the case that there are different SMs. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 13:05, February 28,2013(UTC)
−
Okay, I'veafeelingI'llbetoldsomethingalong the linesof"We'llwaitforconfirmation/adatabook", but I feelthisneedstobeaddressed:"Snake"SageMode. Thusfar,nothingKabutohasdoneuponenteringSageModehasdifferentiateditintheslightestfrom"Toad"SageMode. Even the horns and sucharemuchmorelikelytobeamutationgivenalltheexperimentationthatOrochimarudidandit'snotlikewedon'tknowanyoneotherswhoexperiencemutationsfromtakinginNaturalenergy(Jugo'sclan).Nottomention, as farashasbeentold, KabutoabsorbsthesameNaturalenergyNaruto and codo, andtherewasneversaid to be differentkinds. Thus, leading to the mostprobableconclusion that it's him that's different, not thetechnique.Basically, I justdon'tseetheneedforustodifferntiate.Theylearnedfromdifferentlocations, butotherthanhimnotgainingthetoadeyedesign, it'sseeminglythesame.
+
::I justseetoo many of the same errors to keep replying to over and over; it'snouseto keepreiterating the samethingsjusttohavethesame, and I'msorrytosaythis.butinvalidthingscomingback. Perhapsthebiggesttwoissuesbeingthatanyonewhopracticesyourproposedsagemodeturnsintoa frog, which makesutterlynosense. Secondly being the horn issue and thefactyoukeepmissingthedistinctionanddifferencebetweenpre-exisitingconditionswithKabutoandhisconditionpost-sagemode,whichyoueventhrowuptohismodifications,whichmakenologicalorrationalsense;andcompletelythrowingout any and all in-sage-mode identifiers that one would have, such as Jiraiya,Hashirama, or Naruto. You'retoocaughtup, asalotofothers,onhis modifications and howmuch power they offer him, whichisbeingoverestimatedrelative to thistopic. Though for a third, you fail to recollect that Jiraiya wasn't perfect, which was the causeforhis toad like appearance (and to-note: that which identified him as a sage, DID match Naruto). It's just really not worthitat this point; and I have read ''every''editonthispage,asIdoeverypageIcomeacross, thatishowIlearnandformmyarguments,otherwise it wouldbeanincoherent mess
−
Was it ever even called Snake Sage Mode or implied to be any different at all? [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 06:28, April 13, 2012 (UTC)
−
:If I understand this, do you mean calling this "Snake Sage Mode"? As for the horns, I don't think it's from the experimentation. It's not mentioned to be called "Snake Sage Mode". —[[User:IndxcvNovelist|Indxcv]][[w:c:Naruto:User:IndxcvNovelist/Links|Novelist]] ([[User talk:IndxcvNovelist|Talk to Me]]) 06:37, April 13, 2012 (UTC)
−
::No. In a nutshell, I'm saying there's no need for us to have a section title "Snake Sage Mode" because it has shown no difference from what the "Toad Sage Mode" grants. I said that the horns are likely a mutation from Kabuto's body (which was altered by the DNA of Oro's body which was experimented on a lot) reacting to the Natural energy, given what we know about the Jugo clan mutating because of it and Kabuto experiimenting on Jugo. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 06:45, April 13, 2012 (UTC)
::However, the good points: Yes, natural energy as senjutsu does great things for the body and techniques, this has been long established, but is irrelevant. And if it makes no difference, then why the visual differences, which you say hold no bearing? Why the different teachers? Etc. I could go gon and on with question that hasn't been answered by any.--[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 14:36, February28, 2013 (UTC)
−
:AsIbelieveyouyourselfrealise, ajudgementlikethiscan'treallybemadeuntilKabuto's Sage Mode has been explored fully. Whilethere is currentlynothingreallycontradictory to thosedisplayedbyNarutoorJiraiya, therearenotabledifferencesthatwecanonly''speculate''thereasonsfor, as wellasnumerouspointsthathaven't beentoucheduponatall(with"disadvantages"beingcompletelyabsentatthispoint). [[User:Blackstar1|Blackstar1]] ([[User talk:Blackstar1|talk]]) 13:11, April13, 2012 (UTC)
+
Whatweknowforsureis, thatthatpigmentationaroundeyesisasignofa true Sage. Theproblem is,everythingweknowpoints to asingletechniquesodoeslogic, yettheyturndifferentanimalsforsomereason,thisisbeingjustified as differentSageModeswhilewecan't concludeassuchsinceitmakesnosense.That'slikesayingifIno were Kurama's Jinchuriky, her forms would resemble aboar--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:47, February28, 2013 (UTC)
−
::Okay ~_-, I agree ^^ —[[User:IndxcvNovelist|Indxcv]][[w:c:Naruto:User:IndxcvNovelist/Links|Novelist]] ([[User talk:IndxcvNovelist|Talk to Me]]) 13:25, April 13, 2012 (UTC)
−
==SnakeSage ->SerpentSage==
+
:Off-topic:HiElv!I actually enjoy talking with you, lol. On-topic: I would concede that was true, that "What we know for sure is...". I could agree on that, despite everything, and that isn't to recant everything I've said but just as "if my life depended on it" lol. Regarding the second point, however, I while a single technique and process, the results are different, as you do point out and I agree, but logic in these circumstances is actually circumventing the former because if it is the technique, but the differences are so wildly varied, yet students of the same order (toad, snake, etc) exhibit similar, almost identical changes which are different from others, then logically they are not the same in relation to the results, but not the process (because all that is happening is they gather natural energy to form senjutsu to enter their sage mode). And that's the key here, that logic must always be applied to the entirety and what holds precedence over the other. I want to emphasize, however, I am not saying they are different techniques, as I think still people believe I am stating. The technique to enter the mode and the process in doing it is the same, but the concept or theory of sage mode versus the practicality (or application, if you prefer) of it is completely different. And that's where we don't know where it differs or why, yet the fact remains it does differ. But to end this off with something I've said before, which I think mirrors exactly the general idea people have, we should definitely remove the redundancy in the article, but not to the degree that each version loses its uniqueness, or to perpetuate irrelevant ideas about sage mode (by trying to combine them) until more information is available. -[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 15:01, February28,2013(UTC)
−
I know it's rather late to say this, but, given all Kabuto's boasts about ascending from snake into a dragon, and the name of the cave he studied at, shouldn't it be a '''serpent sage''' rather than a snake sage?
−
([[User:Shadoguardian|Shadoguardian]] ([[User talk:Shadoguardian|talk]]) 01:24, May 25, 2012 (UTC))
−
:It's just a generic name that was used in order to differentiate the modes.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 01:55, May 25, 2012 (UTC)
−
wasn't it calleddragonsage? that's whati read, unless the translationswerewrong. --[[Special:Contributions/67.82.97.72|67.82.97.72]] ([[User talk:67.82.97.72|talk]]) 17:47, June15, 2012 (UTC)
+
:@98.101.165.89 You say you see errors in my reasoning, where? It was stated directly by Fukasaku (and demonstrated against Pain) that not controlling Nature's energy = becoming a Toad or worse. Kabuto mentioned nothing about it,hencenodistinction is to be assumed. And I've not forgotten that Jiraiya had an imperfect SM. My point was was the fact that Jiraiya's facialappearance as a result of the mode wasn't fixed while in that state (the blood contract changed at least once, I do recall). If you have indeed read every post you wouldn't repeat what I've already gone over. Since Jiraiya failed to perfectly balance his Senjutsu chakra, he gained Toady attributes. Kabuto '''already''' had snake attributes, so SM was obviously not the originationofthem like it was for Jiraiya. You're making false comparisons. Again, the horn thing is just a nod to the whole dragons being greater snakes in asian lore, as well as the fact of DNA integration. Also, we don't actually know if Hashirama mastered Sage Mode, it's just an assumption we're making (I'm willing to accept it). We don't actually know if they differ, which is the whole point. Kabuto is a rather special case considering his condition prior to the Mode, so your affirmative assumptions without the actual distinctions stated in the series are going too far at this point. So in doing what the wiki usually does, we shouldn't have the article making somewhat arbitrary divisions. Find a place where the divisions is made apparent, post a link for us to verify, otherwise I don't see any actual motive for this. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 18:06, February28, 2013 (UTC)
−
No.InJapanesemythology,dragonsandsnakesare the samething,butdragonsaremuchstronger. Kabutocallinghimselfadragonwasjust a wayheusedtodeclarehowstronghehadbecome. [[User:Omnibender|Omnibender]]-[[Usertalk:Omnibender|Talk]]-[[Special:Contributions/Omnibender|Contributions]] 18:01, June15, 2012 (UTC)
+
::Firstoff,aboutthe"arbitrarydivisions",thatis the leastspeculativewaytogoaboutit. Itisalsothewayofthe wiki not to doctor up something based on a hunchwithoutsufficientinformation,whichiswhatyouseeminglypropose. Ihavebeenonthiswiki, asmany have, for many years. I am quite familiar with it. I just wish I remembered my name (or in the case it was deleted or something because my name is about 100% the same anywhere).
−
== as oflatestchapter ... ==
+
::I pointed out the errors. And I shouldn't have to post a link as Igotoelaborate lengths to explain, and it isn't hard to even look for yourself and re-read the pages where it applies. I mean, what would it help? You remember the pages, correct? The imagery, the words, etc? I can do it, but I fail to see how it would help when the pages and the chapters revolving around the content are small enough to memorize, and it is nice to familiarize ones's self with the pages when discussing it anyways. If you truly will not even consider something with well formed arguments, what are the linking the same pages that you most likely remember vehemently going to do? Especially after all of this discussion about it from everyone, with more than a few very well-formed arguments from them.
−
# so was Kabutousing"SageMode"or"SageTransformation" ??? sincehehaslearnedit and histechniquesareSageTechniquesthenitmust be the first, butdoesn't thisconfirmthathewasusing"imperfectsnakesagemode"due to physicaltransformation?
+
::It was statedbyhim(Fukasaku),butthere'snoinclination to believe all people who train in senjutsu turn into toads, otherwise why Toad Sage teachers? Why have any difference in 3 of the 4 known human sages? Ikeepreiteratingthisand yet no rebuttal is brought forth. We could just have all people who dabble in sage mode become Toad Sages, and betaughtbyToads.Butthereisa Snake sage, and given that, plus the fact they will teach humans, there would be a lot of parallels with the frogs. That's a generally understood concept. But also notice I am not saying to put it into the article, becauseit hasn't beenintroduced.Iamnotasfoolishandignorantasyou believe I am, or have the lack of motivation to read all of the edits. That isn't the topic of discussion, however. And just because you keep going over it, same as I, doesn't mean either of us are correct or that both of us didn't read anything.
−
# what are the differences between sage mode and sage transformation and how to handle that ... is Orochimaru a Sage after all?
−
# doesn't this confirm that "power of the white snake" is nothing else than Snake Sage Mode?
−
I added some convo http://naruto.wikia.com/wiki/Talk:Orochimaru%27s_Juinjutsu#Related_to_Sage_Mode
−
how are we going to handle this? Since Sasuke was using Orochimaru's powers of white snake, didn't he have Sage Mode as well?--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 13:33, July 10, 2012 (UTC)
−
*StopcomparingtoadSageMode to snake SageMode, they mightnotbe the same. Thetransformationmay have beendue to the fact thathehadJūgo'sDNA in him.
+
::Jiraiyawasimperfect,yes,and you did, at least in text form if not memory, forget about that, or you did not clarify, at least. You suggested Jiraiya was perfect and that the reason for the differencecompared to Naruto was that sage mode is peculiar, essentially. To quote, "Heck, Jiraiya's appearance was crazy and didn't really resemble Naruto's at all. ", and given the context combined with the rest of the sentences surrounding it, that's how it came out. It did resemble it, however, in his eyes. Jiraiya's frog-like features were a result of him being unable to perfectly balance natural energy and his own, not a result of just having sage mode activated. But as for Kabuto, yes, he already had them due to modifications a la Orochimaru. Yes, that's been quite established, by others and myself. The difference, and the error, however, is the overwhelming power of emphasis you give it relative to sage mode; the two are not related. Kabuto's horns are a nod to Asian folklore -- I'm the one, IIRC, that first brought it up, unless I missed it in someone's earlier edit. But that doesn't mean it is just a nod. We would infer that without having Kabuto being so excited about being a dragon and not a snake;or that Orochimaru (the snake) also learned from the Snake Sages, which suggests that, similar to anyone learning from the Toads, or wherever Hashirama learnedhis, they willexhibitsigns relative to where they learned it. He actually isn't a special case when it comes to the mode, and that is highly speculative you believe so. Onthecontrary, it isn't, and shouldn't be special. Yes, he is modified, but with what rational do you assert that makes a difference at all? I don't understand why, despite me ''profusely'' emphasizing his pre-existing condition pre-sage mode, that you think I believe it is a result of sage mode. I NEVER suggested that. So no, there are no false comparisons. I am unbelievably aware, and have continuouslystated, my understanding, at great, pain-staking lengths, of the differences of Kabuto and imperfect Toad Sage Jiraiya. I am astounded. Regardless of how you feel, there are things which cannot be denied when it comes to the different products resulting from the same technique. What we don't know is how it happens. There are divisions, but you are seemingly blending them, or outright ignoring them. The fact therearesomany differences resulting from the same technique (sans basic improvements from senjutsu (improved strength, etc; improved ninjutsu, etc)), even if the differences are only visual (which is just as huge as anything else), suggests a division. Even if you don'tbelieve in a difference between Kabuto and the Toads Sages, then explain Hashirama, who has no pre-existing condition and yet changes beyond what we have seen from the Toad Sages and Snake Sages.
−
* Sage Mode gathers natural energy. Sage Transformation is everything Jūgo does with his body.
−
* Haven't a clue what you're talking about. Orochimaru's power of the white snake only has to do with his many methods of reviving himself.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 13:57, July 10, 2012 (UTC)
−
::Also remember, Kabuto did learn senjutsu from the Snakes. I don't know about Orochimaru, but Kabuto was indeed a sage.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 14:00, July 10, 2012 (UTC)
−
:::Orochimaru i don't know anymore. He apparently used senjutsu, but I'm not sure if he was a sage or not.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 14:00, July 10, 2012 (UTC)
−
butrememberkabutosaidthatsince oro'scurrenthost was unable to handleit he couldntmastersenjutsu.[[Special:Contributions/71.71.58.224|71.71.58.224]]([[Usertalk:71.71.58.224|talk]])14:09, July10, 2012(UTC)yomiko-chan
+
::Andyouareright,wedon'tknowif Hashirama is perfect. I never suggested he was.And the only reason people believe Kabuto is perfect is because of his speech to Itachiand Sasuke about how he becameadragon instead of a snake like Orochimaru, which, given the folklore and just general comparison (you do not even have to know about the folklore) that Kabuto was making, suggests the top/best. Buthe could be imperfect for all we know, since it isn't directly stated. He could've, hypothetically,even been in sage mode the entire time given his modifications based on Juugo. But I am not suggesting that, ifthat's what you believe.
−
I believeOro'sanimperfectSagebutaSagenonethelessbecauseheusessenjutsu(outsideofJugoandhisclandecor). I'mgood with addinghimassuchorstavingif you guyswannawait for abitmoreinfo.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 14:20, July10, 2012 (UTC)
+
::I trulyamdoneatthispoint.WhenithasgottentoapointIfeeltheneedtowriteso much, I need, personally, to stop; it'sgotten out of hand with alloftheassumptionsyoubelieve I am making, the assumptions I do not read, etc. I have no patience for it anymore.If you still,atthis point, would like me to post links to the chapters for you,eventhoughthey honestly will do nothing to aid, that is something I would do on your talk page.--[[Special:Contributions/98.101.165.89|98.101.165.89]] ([[User talk:98.101.165.89|talk]]) 20:15, February28, 2013 (UTC)
−
Isn't itmorelikeKabutoisanimperfectSage, whileOrochimaru is perfect?
+
I just believe we need to remove speculation and use neutral labels since we can't confirmnordenysomethings.ButI'mpointing out, thatHashirama supports my hypothesis. I believe natural energy changes everyone in a different way and the resulting form is what they resemble the most/are associated with, there's more that hints on this (look at curse mark users, they don't turn into snakes, do they? Also Jugo Clan's members were also shown each with a different form)
−
ThestatementaboutOronotbeingabletohandle it refer to thehostbodiesbeingweakfor that, norhimhavinganyproblemswith it.
+
Evenperfectsagesgetanimaleyesofaspecies, yet, Hashirama's eyes didn't change at all, he just gained the pigmentation (true sign) and a marking on forehead resembling the third eye, thus it has nothing to dowithanimaltrainersatall, rather does with users themselves. The same thing can't have different effects on individuals, that's nonsensical, rathereachindividualreactstoit differently. Instead of "x type sage mode" it should be "x user in sage mode" there's only 2 official forms, perfect and imperfect.
Andasstated,manythingsrepeatinthearticle,there'sthesameadvantages&disadvantagesforeveryonebydefault, thedifferencesstemfromtheiruniqueworkarounds/counteringonly,like the shoulder-merging-no-jutsuandinsertjugodnasoyoudon'thave to sit all day thingy--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 21:09, February28, 2013 (UTC)
−
:Have you taken into consideration that Kabuto has Jūgo's DNA within him and the now-named [[Sage Transformation]] which might be responsible for the transformation? The way Kabuto put it made it sound like he was the perfect Sage, not Orochimaru.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 14:33, July 10, 2012 (UTC)
−
Jugo'sDNAcausesrandom transformations, not snake transformation. He just said Orochimaru was unable to use Sage Mode WITH weak host bodies, while Kabuto's own body was capable of using and controlling Natural Energies and all that DNA and that he considers himself stronger than Orochimaru and a "Dragon"
+
==ArticleRestructureor not?==
−
Also about the "power of white snake" part, doesn't make it sense that it's the same thing as Snake Sage Mode? Kabuto thought that Orochimaru was still in Sasuke and said that he (Sasuke) also possess this power, indicating it's not a result of body modifications, at least not alone--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:42, July 10, 2012 (UTC)
−
:What you mean by random? Forming axes, pistons, jet boosters and needles aren't random, his transformations are very controlled. The only thin that is uncontrolled is the fits of rage that come on. I don't want to speculate but it's very possible that Kabuto grew those horns himself (the only acutal "transformation" that happened to him) well and the navel-snake which I noticed was being hidden in the frames for some reason.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 14:52, July 10, 2012 (UTC)
−
Yes,Iworded it wrong ... "custom" is what I meant.Idon't see why the workings of Toad and Snake modes should be different, that's speculative ... naturalenergyis natural energy and sage mode is sage mode. We can go only with facts, and those are that Orochimaru absorbed natural energy and his own chakra without any physical change (like a true sage) while it was the reasonforKabuto'stransformation,andheturnednormalafterwards.Jiraiya turned half toad due to not being able to perfectlybalanceall3energies, Kabuto appears to be exactly the same case ... Orochimaru is apparently also a Sage and it looks closer to Naruto'scase--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:59, July10, 2012 (UTC)
+
Sincetheprevioussectiondidn't amountto... anything(mybad). So, is the articlegoingtoberestructredornot?Nooneseemed to come to anyoverallagreementinregards to the technique. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 00:32, March1, 2013 (UTC)
−
:Except didn't Kabuto call his Sage Mode perfect, and thus for Snake Sage Mode perfection is looking like dragon? Also, remember Orochimaru looked like a flipping mess his entire life, well before he could have become a Sage.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 15:06, July 10, 2012 (UTC)
:ThewayIseeit, thearticleshould be re-structured like this:
−
Kabuto: "I have surprassed Orochimaru, I'm a dragon now"
+
::*SageMode
−
Somethinglikethatwasstated,don'tknowwhattomakeof it ... also remember that Itachi suggested that Kabuto must have a Sage Mode by his appearance.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 15:09, July10,2012(UTC)
:But surpassing someone can't mean that he's worse off than them? Also, lmao @ "Orochimaru looked like a flipping mess his entire life" Ratchet ( '-') --[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:HyūgaSymbol.svg|20px]][[Usertalk:Cerez365|<sup>(talk)</sup>]]15:29,July 10, 2012 (UTC)
+
::::*increaseinpowerofnin,tai,genjutsu
+
::::*cloak of natural energy
+
::::*ability to sense chakra
+
:::::*increase in reflexes/perceptual abilities (yes its the same thing, naruto could dodge the raikage's impossibly fast spear, kabuto could dodge sasuke's impossibly fast arrow)
::Thisway, redundancyisreducedwhilekeepingthingsseeminglyuniqueseparate.Hopethismakespeople happy. [[User:MangekyoSasuke|MangekyoSasuke]] ([[User talk:MangekyoSasuke|talk]]) 01:23, March 1,2013(UTC)
−
Also any more opinions on the white snake powers being snake sage mode abilities?--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 16:55, July 10, 2012 (UTC)
−
I believe the extra snake traits Kabuto has are a result of the DNA mess he shoved down his veins. His manipulation of the pure natural energy when he used Sage Art: Inorganic Transmigration to give life to the cave stands to reason that he has full control and balance over natural energy and as such makes him a perfect Sage. Orochimaru on the other hand may not be a perfect Sage due to the frailty of his host bodies since in order to master senjutsu one must have a strong chakra and body. Now in regard to the toad/snake differences...they shoudn't exist. Sage Mode is Sage Mode no matter which medium taught you...at best there should be a trivia note or one in the abilities section saying something: "the Sage Mode user gains different animal traits depending on which sage taught him". Jiraiya could change his body to gain more toad traits, Kabuto also did the same. There shouldn't be any separation of the Sage Modes, they are all the same. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 17:41, July10, 2012 (UTC)
Butthesnakemodificationcan't be due to DNA mess, Orojust sucked his own chakra and natural energies from Kabuto and he reverted back, theDNAs juice is still in his body.
Jiraiya also could use great Sage techniques yet his manipulation wasn't without physical changes, Orochimaru himself sure is a perfect Sage since he was just looking for a host body strong enough to hold his power, the thing that he sucked out Kabuto's Sage Mode without any problems proves this. I agree on the rest, differences between Sage Modes are speculative, they all should give the same benefits ... only the "sage arts" are different as each species has their unique techniques most likely--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 18:25, July 10, 2012 (UTC)
−
:I don't agree that Orochimaru is a perfect Sage...as Kabuto stated, he tried to master the Sage arts but was unable due to his frail host bodies, may have the knowledge but not the physical requirements which is like an inverse of Jiraiya who has the requirements but never perfected his skills...and remember Oro's own body and DNA are a result of countless experiments and it's effects done to other individuals aren't fully known due to the fact that we only have Kabuto as an example but Kabuto already had snake modifications before using Sage Mode. As in regards to Kabuto he likely took all the modifications from him because they were all connected to his DNA since it was all mixed together and most of them already had a DNA connection to orochimaru. One curious thing the series has been showing through out it's run is the bigger connection between chakra and DNA/remains. And Kabuto can't have the DNA juice because he reverted back to human form and he already had snake changes before going sage. Oro at least took all of Kabuto's modifications. In regards to the article it should be re-written as a ''single '' Sage Mode. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 19:00, July 10, 2012 (UTC)
−
Well, but he HIMSELF (his own body) can handle it, only host bodies couldn't ... now he was revived in his original body. So ur saying that Oro tookall the powersKabutohas obtained from DNA juices? O_O It would be weird if Kabuto had to makeanexperimentandinsertDNAintohisbodyandOrochimarujustplacing his hand on him stealing it ... but without speculating, Iguess we will see if Kabuto still has his new powers or not later.
+
Isupport the proposedrestructuringproposed to cutdowntheredundancy.[[User:Omnibender|Omnibender]]-[[Usertalk:Omnibender|Talk]]-[[Special:Contributions/Omnibender|Contributions]]22:57,March2, 2013(UTC)
−
But the thing that he was snake-like even before going Sage Mode and now is normal has a point ... Orochimaru just might have suppressed the alternations from DNA.
−
For the Sage Mode, I agree ... Snake and Toad modes give the same benefits--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 19:14, July 10, 2012 (UTC)
−
Here'sahint...Orochimaru's original body hasn't existed for at least two to three decades which was when he started his experiments...he can't handle the natural energies for himself...he's been living in these altered host bodies for decades...if got Sasuke's or maybe Kimimaro's body if it wasn't diseased or Kabuto's since he was able to handle natural energy would be a different situation. And yes i am saying that Orochimaru took all of Kabuto's additional powers...Kabuto'sreggressiontoanormalhuman form stands to reason with it and most of the individuals Kabuto spliced his DNA with already had Oro's DNA nixed ub which makes for a perfect anchor, plus...we do not have a full grasp of Orochimaru's abilities or the full extent of his experiments, so i'd say him having the abilityto absorb any modifications which ALREADY stemmed from his DNA is a minimal question don't you think? [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]])19:30, July10, 2012 (UTC)
+
:Iagreewith the cutting of redundancy. Iremainagainsttheremoval of the Toad, Snake, whatever the hellHashirama is.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 00:27, March3, 2013 (UTC)
−
That's not true, Orochimaru's original body is thesameoneas his "snake form" he has his original body all the time, hedidn't throw it away ... white snake is his original altered body but he can also revert into human form if he wants even without a host, he can shed and create a new body anytime aswell.
+
Cool, who is bored?--[[User:Elveonora|Elveonora]]([[Usertalk:Elveonora|talk]])05:04, March3, 2013(UTC)
−
For the Kabuto part, okay. The point is that he must have learned Sage Mode before he took over his first host body, he wouldn't be a sage if he didn't.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 19:36, July 10, 2012 (UTC)
−
: I don't think so...acording to Kabuto's flashbacks he would have tried to learn Sage Mode sometime after he was taken under Orochimaru's, which by then he would have started his process of jumping bodies...his original body was likely destroyed due to time and the tool of his experiments...and like Kabuto said he wasn't able to master it...maybe now with what he took from Kabuto, he'll be able to do it...think about it...why wouldn't hasn't he ever used such a powerful ability such as Sage Mode on any of his battles? Like the one with the Four-tail Naruto, or the final battle against Itachi, or the even better the one against the Hiruzen? Doesn't make sense in my book. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 20:30, July 10, 2012 (UTC)
−
:: Not to mention Kabuto explicitly said Orochimaru tried learning Sage Mode, but couldn't achieve it. So he isn't a user.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 21:01, July 10, 2012 (UTC)
−
:::Orochimaru was explicitly said in this chapter to take back his senjutsu chakra from Kabuto, and to have put that senjutsu chakra in the cursed seals he applied. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 21:08, July 10, 2012 (UTC)
−
:: Its likely a mistranslation. Kabuto confirmed that Orochimaru tried learning Sage Mode, but he failed, remember? His body or chakra just wasn't strong enough for it.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 21:20, July 10, 2012 (UTC)
−
:::It wasn't a mistranslation, Kabuto meant that Orochimaru's host bodies couldn't properly utilize his senjutsu, a lot of people just misunderstood that. [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 21:23, July 10, 2012 (UTC)
−
::::Seelentau has already seen the raw. And even if you don't know Japanese, you can clearly see in the raw "senjutsu chakra" in the panel that shows that Anko no longer has the cursed seal. Kabuto said that Orochimaru couldn't become a true sage because his host body couldn't handle it. At the time, most of us, myself included, understood that as Orochimaru being incapable of forming senjutsu chakra. Turns out he could, he probably couldn't make a perfect sage mode with the balance of the energies, just like Jiraiya couldn't. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 21:26, July 10, 2012 (UTC)
−
:::::Which means he has, at the very least, an imperfect sage mode like Jiraiya right? [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 21:29, July 10, 2012 (UTC)
−
:::: Except he hasn't even shown Imperfect Sage Mode like Jiraiya has. And why wouldn't Itachi or any other character mention that Orochimaru has Sage Mode himself? Why would Kabuto explicitly said Orochimaru tried to learn Sage Mode but couldn't achieve it? For a comparison, Kinkaku and Ginkaku could use Kurama's chakra, but they aren't actual Jinchuriki like Naruto is.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 21:32, July 10, 2012 (UTC)
−
::::: Kabuto never said Orochimaru couldn't use senjutsu, he said that Orochimaru's host body couldn't utilize it. That's a big difference. [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 21:36, July 10, 2012 (UTC)
−
:::: He said both. Both the bodies he tried to take over and his own were unable to use Sage Mode. He probably could get as far as the equivalent of using Toad Oil so he could sense Natural Energy on his own but he couldn't get to use Sage Mode itself.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 21:42, July 10, 2012 (UTC)
−
:::::So he could only 'sense' natural energy when in this very chapter he's explicitly stated to use it and absorb it? And according to this wiki, "Those who are able to learn to use senjutsu are able to enter a physical state called "Sage Mode"" Being able to use senjutsu chakra is literally the only prerequisite to using sage mode. [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 21:46, July 10, 2012 (UTC)
−
::::::: Jugo could also sense chakra. Kabuot said it himself, Orochimaru tried and failed, and had no bodies strong enough to learn it. He could only get as far as creating senjutsu chakra, but not Sage Mode himself. Kabuto explicitly said Orochimaru couldn't achieve Sage Mode. So stop adding that he did.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 22:17, July 10, 2012 (UTC)
−
:::::::: Omnibender is the one that keeps having to add it back, so you need to get over it already and leave it alone. [[Special:Contributions/68.35.56.104|68.35.56.104]] ([[User talk:68.35.56.104|talk]]) 22:26, July 10, 2012 (UTC)
−
::::::Anko is the oldest cursed seal Orochimaru applied, she's the one who defined the 10% survival rate. Anko isn't known to have left Konoha, so Orochimaru did this while he was still in the village, before taking someone else's body with Living Corpse Reincarnation. If her seal had senjutsu chakra, that means he wasn't limited by whatever host body he had at the time. He would have Jūgo already, but not a new host body. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 21:53, July 10, 2012 (UTC)
−
Omniisright,OrocanuseSageModeforsureandlikely could do soevenbeforeswitchingbody. Andno,hisoriginalbodyisn'tdestroyed,hestillhashisoriginalbodywithhimself,it's thewhitesnake.
+
I'msomewhatbored(andill)now,andnoworktoday,soI suppose I could do it.:-)Seelentauthinkswe should as well (my talk page). Hecouldonlythinkthatweshouldsplitthearticlebasedonuser.@TU3WouldSeelentau's orMangekyoSasuke'ssuggestions satisfy? :) Or how about these?:
−
People should stick with proper translations ...
−
EDIT: the thing why he didn't use Sage Mode is because the bodies he took over couldn't handle it--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 23:44, July 10, 2012 (UTC)
−
:Exactly. Not to mention that he said he infuses his curse seals with sage chakra and anko was one of the first 10 he put a curse seal on, which he did before leaving the village (which means before he ever switched bodies). We're all in agreement aside from NaruHinafan(SuperSaiyaMan) up there, and their opinion quite obviously isn't going to change regardless of our evidence (that oro had it before switching bodies and that kabuto never said oro couldn't use it, he said that oro's host bodies couldn't use it). So can we finally put this to rest and update the related pages accordingly and leave them that way? [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 23:46, July 10, 2012 (UTC)
−
Some people just can't put their bias aside and stick with proper translations and are using the false ones as "proof" for the way they want to have it.
+
:
−
IthinkKishimotohasbiggerwordonthisthananyofusand the chapterclearlystateshehas a SageMode.
+
*Theopeningsectionofthearticlealreadydoesadecentjobgoingover the generalabilitiesofSageMode, so it would a goodplace to make use of in reducing some redundancy.
−
The ongoing discussions though are if Kabuto/Orochimaru have a perfect/imperfect version and to merge and update the power-ups part as it's false only snake sage mode enhances reflexes and gives better perception because toad one does the same and there's nothing to indicate any difference ... then kinda on a side-note there's the mini-topic about if Orochimaru's power of the white snake is actually Snake Sage Mode--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 23:55, July 10, 2012 (UTC)
−
:I fixed the related pages again to show that he had SM. It's fine if the specifics of imperfect/perfect are still in discussion, the main point is that we are in agreement that he DOES have sage mode and the pages will reflect that fact. EDIT: for the sake of that discussion, I would consider Orochimaru's SM perfect since he has no physical body changes (like Kabuto's horns and Jiraiya's nose/hands/feet). Aside from the snake eyes and eye makeup, which is EXACTLY what happens to naruto (toad eyes and eye makeup) when he's in perfect SM.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 23:58, July 10, 2012 (UTC)
−
Thethingisthat Oro had the eyes and "make-up" (lol)sincechildhood...soevenifhewasusingPerfectSnakeSageMode,wewouldn'tlikelynotice. Ithinkit'sobviousit's Perfectversionashewas"born"fromSenjutsuchakraandabsorbedNaturalEnergyalongwithhisownchakra from Kabuto without any effort and no transformation ... alsorememberthatnowheiswalkingaroundinhis own body without a host, sohemightactually use it if he didn't already--[[User:Elveonora|Elveonora]] ([[Usertalk:Elveonora|talk]]) 00:17, July 11, 2012 (UTC)
:That's why I think his is Perfect too. Think about it, we now know that he applies sage mode chakra to curse seals, and we saw him apply one to sasuke, which means he'd have to have been in sage mode to do so, and he looked no different than he always does. His eyes and eye markings (which would be the only noticeable effect of perfect SM) always being present was Kishi's clever way of hiding it so long. Plus, like you said, one would assume he'd have to be in SM to straight up absorb sage chakra out of Kabuto, and again, he looked like he always does. [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 00:21, July 11, 2012 (UTC)
−
:Beforewecontinueany further, becauseeverythingIreadjust seems to befeedingoffeachother.WherewasitsaidthatOrochimarucould even enter Sage Mode? Gathering natural chakra is one thing, but actually entering Sage Mode is another.--[[User:TheUltimate3|'''TheUltimate3''']] [[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3| <sup>(talk)</sup>]] 00:27, July 11, 2012 (UTC)
+
*Create2moresections, ''KabutoYakushi''and''HashiramaSenju'', to listanycurrentorfuturequirks(ifany)oftheirrespectiveusages.
−
::Because being able to manipulate, use, and absorb senjutsu chakra (which isn't natural energy, it's the combination of natural energy and one's own chakra [what you learn to do in SM training]) IS sage mode. It's the only thing you have to be able to do to enter sage mode. If one can use senjutsu, then that's sage mode. [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 00:30, July 11, 2012 (UTC)
−
: Kinkaku and Ginkaku can manipulate and use Biju Chakra, does this make them Jinchuriki? Not to mention that Orochimaru was specifically said to be UNABLE to use Sage Mode, having FAILED at it! Kabuto explicitly said it!--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 00:36, July 11, 2012 (UTC)
−
::Again, Kabuto never, ever said "Orochimaru can't/couldn't use sage mode". He said that Orochimaru's host bodies couldn't utilize it. That in no way says that Orochimaru can't use it. Second, even if kabuto HAD said that Orochimaru couldn't, one character's words don't trump what we actually witness, which is Orochimaru using senjutsu. Senjutsu can only be used by sage mode users. This has already been accepted, even by mods, so just leave it alone already.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 00:40, July 11, 2012 (UTC)
−
@Ultimate,SenjutsuChakra= Sage Mode user
+
*Noteinthetrivia that we don't currently know if these are distinct Sage Modes or user specific oddities.
−
@SuperNaruHinaManFanDamPan, you were already told that it's not what was said.
−
Kinkaku and Ginkaku were pseudo-Jinchuriky, Orochimaru was never said to be UNABLE to use Sage Mode, only that he couldn't find host bodies strong enough to handle it
−
Also I'dlike Omni's and Cerez's opinion on this one since I respect their opinion the most for being quite frequent editors ... Jetdeagon, so are you suggesting that hecoulduseSageMode/Senjutsuchakraeven with host bodies? That would be KINDA contradicting with Kabuto's comments on host bodies. But I'm not sure on this one as well, since part of me says "yes" and the other part "no" I think that "power of the whitesnake"refertoSageMode/SnakeArtsandthathis Body Shedding and Gathering of the Snakes and other such related techniques along with regeneration are a result of it.
+
I think that maysatisfythoseofuswhodisagree as to the nature of the technique.Thoughts?[[User:Skitts|Skitts]]([[Usertalk:Skitts|talk]])15:17,March3,2013(UTC)
−
That would explain why the host bodies are weakening and rejecting Orochimaru, due to not being able to handle Natural Energy properly. If Sasuke was being taken over, he would last for not a limited time by this issue as the true purpose of Curse Mark appears to potentially prepare host bodies as those able to possess and use Curse Mark have a higher chance to handle Sage Mode thus Orochimaru, and for revival as well.
−
The only way how to solve this issue I think is if someone could provide a RAW of both the chapter when it's being talked about it in Sasuke and Itachi vs Kabuto and of latest chapter as well, and to have translators here on wiki to solve the issue--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 00:42, July 11, 2012 (UTC)
−
:I wholeheartedly agree, and I was not suggesting that Orochimaru could use senjutsu with host bodies, I don't know what gave that impression, maybe I worded something wrong. The fact that he can't grasp is that one cannot use senjutsu chakra without being able to use sage mode. senjutsu chakra comes from sage mode. and Omni already said he agrees with the fact that Orochimaru had sage mode, and he himself edited both this page and Orochimaru's page earlier to reflect that. And Cerez said earlier in this very conversation that he also believes Orochimaru is a sage.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 00:45, July 11, 2012 (UTC)
−
: Which mod has accepted it? Orochimaru just used senjutsu, he has never been shown in Sage Mode or in a state of Sage Mode. We know when Sage Mode is being used. Naruto achieved a Sage Modeesque state when he finished his Toad Oil training, does that make him a Sage Mode user at that time? Even though he was creating the Senjutsu chakra then? And Kabuto said that Orochimaru never achieved Sage Mode despite training in it. [[http://www.narutobase.net/manga/Naruto/579/16|"Orochimaru-sama tried to immediately gain that ability, but, he hadn't found the right body that could bear that ability so..."]] Orochimaru just using Senjutsu means he achieved what Naruto did at that point of training with the toad oil. He's still not a Sage Mode user and never will be until he actually USES it.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 00:47, July 11, 2012 (UTC)
−
::What you cannot seem to grasp is the fact that if one can use sage mode chakra, one can use sage mode. they are hand in hand, it's been long established.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 00:49, July 11, 2012 (UTC)
−
: Naruto achieved Senjutsu Chakra use when he completed Toad Oil Training. Did that make him a Sage Mode user then? Yes or no, Jetdeagon?--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 00:50, July 11, 2012 (UTC)
−
(edit conflict x4) @NaruHina fan, I think so, it did. @TheUltimate3 In the raw for this weeks's chapter, the panel that shows that Anko no longer has her cursed seal, you can clearly see in Orochimaru's speech bubble that he mentions senjutsu chakra. Both scanlations I've read translated that as saying he put his senjutsu chakra in the cursed seals. Seelentau himself confirmed he says senjutsu chakra in the chapter's talk page. When Kabuto used Sage Mode, he said that he surpassed Orochimaru because Orochimaru's host body couldn't handle senjutsu, Orochimaru was limited by the host body. In his original body, before he ever switched it, we see that he was capable of using Sage Mode by the fact that a cursed seal from the first ever batch had senjutsu chakra in it. You can only make senjutsu chakra if you're a Sage, meaning he would have been able to enter Sage Mode. Jiraiya couldn't balance the three energies perfectly, but he's still considered a sage, and his techniques were still considered senjutsu. While we don't know if Orochimaru could balance them perfectly, he very clearly and unambiguously says he put his senjutsu chakra in the cursed seals. Using senjutsu means one has to be in the Sage Mode. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 00:52, July 11, 2012 (UTC)
−
:: Naruto only became a Sage Mode user after he actually achieved it. The Toad Oil Training wasn't enough even though he could use Senjutsu chakra then. And when did we EVER see Orochimaru in Sage Mode? Again, until he actually uses it, he shouldn't be listed as a user.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 00:57, July 11, 2012 (UTC)
−
:::You really, really need to understand that you HAVE to be SAGE MODE to use senjutsu.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 01:00, July 11, 2012 (UTC)
−
:: Except you don't if you're still in training. Naruto achieved the ability to use Senjutsu when he was doing his Toad Oil Training, yet he wasn't any close to being an actual Sage Mode user then. Not to mention again, he's never been shown using it and isn't it a standard practice on the site to wait until that happens before listing jutsu users?--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 01:01, July 11, 2012 (UTC)
−
Girl, youreithercan'treadproperlyoryourEnglishisbad...itsays:"hehadn'tfoundtherightbody that could bear that ability" not: "hecouldn't have used that ability for he had aweakbody"
Also your Naruto comparison is flawed, Naruto was using Sage Mode since he has learned how to absorb, combine and use Natural Energy along with his own chakra to create Senjutsu without the use of any oil ... I don't see Orochimaru using any oil.
−
The oil made Naruto absorb natural energies, but he only mastered Sage Mode when he himself has mixed it with the 2 energies that make up his chakra--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 01:05, July 11, 2012 (UTC)
−
:And we've never seen anyone use senjutsu outside of sage mode, either (because you can't).[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 01:07, July 11, 2012 (UTC)
−
:: I'm a guy, Elveonora. And it still valid, it also implies he couldn't use Sage Mode itself because he kept searching for stronger bodies to bear the ability. And you don't get what I'm saying, Naruto while using Toad Oil could absorb Nature Energy and had to balance it so he wouldn't turn to stone. Thus he gained Senjutsu there. What I said is for all we know, Orochimaru achieved a SIMILAR state, and never achieved Sage Mode himself. Thus, until Orochimaru ''actually uses it'' he shouldn't be listed as a user.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 01:18, July 11, 2012 (UTC)
−
:Natural energy and being able to use senjutsu chakra (which is natural energy combined with the other two energies within one's own body, which is what is used in sage mode) are two different things, I think you think they're the same which is why you're not getting this. Being able to use senjutsu means you're a sage, that's all there is to it.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 01:21, July 11, 2012 (UTC)
−
::I would like to remind this discussion that perfect balance isn't required. Jiraiya never achieved perfect balance of the three energies, but he was still a sage. From the moment you can balance natural energy with the other two enough so that it's stable, you've made senjutsu chakra, meaning you're in Sage Mode. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 01:32, July 11, 2012 (UTC)
−
@I'maguy,(yes, I'mgonnabeasignorantasyouare)noitimpliesthathishostbodiescouldn't use it andhewassearchingforonethatcould(hint:Sasuke) the thingNarutodidn't balanceitout, he wasturninginto a Toadand the grandpatoadhadtosmashhimwithamagicalsticktoreverthimbackintoarameningredient.
+
Pleasedonotdiffer between imperfect and true sage mode, sincethatwouldsoundlikethereismorethanonesagemode.Jiraiyaisinsage mode, Naruto is in sage mode. The only difference is that Naruto can use it betterthanhissensei.Hesimplyhasmorecontrolover the naturalenergybalance in his body, that doesn't makehissage mode anything different. Write something like "Since Jiraiya has no complete control over the natural energy in his body, he looksmorelike a toadthan Naruto does, who can maintain a perfect balance of the threeenergies.".AsIsaidonyourtalkpage,Skitts,thereisonlyoneSageMode,there'sno perfect or snake or dragon sage mode. [[User:Seelentau|Seelentau 愛]]<sup>[[User Talk:Seelentau|議]]</sup> 15:45, March 3, 2013 (UTC)
−
Naruto gained Sage Mode the moment he didn't need any help to maintain the state, the last part of your posts makes absolutely no sense--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 01:48, July 11, 2012 (UTC)
−
:...you called me 'girl'. And should you prove that Orochimaru doesn't need help to maintain the state? Again, he could have gotten as far as the training and no further. Hell, from the sound of it (when he got Anko the Cursed Seal, just after getting Jugo) he had his original body back when he first went to the Cave. And kabuto said he kept trying to get stronger and stronger bodies since either his own or the others couldn't bear Sage Mode. Why can't we actually wait until he uses it before listing him as a user?--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 02:01, July 11, 2012 (UTC)
−
then...OroISasagebecausehecan use SENJUTSU chakra...but would that mean that Sage mode isaparenttechniqueofthedifferentCurseseal?[[User:Saeyatachi|Saeyatachi]]([[Usertalk:Saeyatachi|talk]])02:01, July 11,2012(UTC)Saeyatachi
:::Theearthand heaven seal pages should beupdated with a tidbit about the factthattheyarefilled with orochimaru's sage chakra, and sagemode as a parent jutsu, but I'd waitfor the go-ahead from omni before adding the latter. And, @Naruhinafan,it'sbecomereally, really, reaaally obvious that you'renevergoing to changeyouropinion,butthefact is that the manga has established irrefutably that if one uses senjutsu chakra in any way/shape/form, they have to be insage mode. If one uses senjutsu or sage chakra, they are a sage. Omnibender put it perfectly a few posts up, if that isn't going to convince you to accept it, nothing will, but it's been decided already.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 02:12, July11, 2012 (UTC)
+
EDIT: thearticle should coveronly the techniqueitself,thosebodilychanges and shitaren't a partof the technique, morelikeaconsequenceoffailing to balancenaturalenergyperfectlyandshould be coveredelsewhere--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 15:58, March3, 2013 (UTC)
−
: How? Orochimaru's originalbodycouldn'tbearSageMode, thusnotmakinghima user. Whichiswhyhecontinuallytried to getstrongerandstrongerbodies.That'swhatKabutosaid. And for allweknow, hecouldhavejustusedSenjutsuduetotheCursedSeal,notbecauseofSageMode.Again,untilheactually ''uses'' it, heshouldn't be listed.--[[User:SuperSaiyaMan|NaruHinafan]] ([[User talk:SuperSaiyaMan|talk]])02:08, July11, 2012 (UTC)
+
:It's simple:Themore balanced thethreeenergiesare, thelessfroggyarethe looks of the user. Thisgoesfromturningintoa frog to somewhatlookinglikeatoadtohavingeyeshades. And youarewrong, thetechniquedescribestheeffectsofnaturalenergyinahumanbody.Thelooksareapartofthoseeffects, thusthey should be covered in this article.[[User:Seelentau|Seelentau愛]]<sup>[[User Talk:Seelentau|議]]</sup>16:01, March3, 2013 (UTC)
Yes, in the user section but not as a part of "powers" description.ButIbelievethesechangesbelongmorehere[[NaturalEnergy]]sincenatural energy is responsible for physical changes outside of sage mode--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 16:03, March 3, 2013 (UTC)
−
Ifhegotonlyasfarastrainingbut no further, hecouldn't haveusedit,buthedid.
+
:Ofcoursenotinthepowers-partofthearticle. But there are no physical changes outside of the sage mode. Going into Sage Mode means absorbing natural energy, whichmay result in physical changes if the natural energy isn't inbalancewiththeothertwo. The physical changes are a direct result of absorbing natural energy. [[User:Seelentau|Seelentau 愛]]<sup>[[User Talk:Seelentau|議]]</sup> 16:07, March 3, 2013 (UTC)
−
He has already used Senjutsu chakra (Curse Marks) and has shown ability to absorb Senjutsu Chakra thus there's no doubt, get over it.
−
Honestly, it's similar case to how Amaterasu and Tsukuyomi are being listed in Madara's infobox, cause the canon states he can do it. If you are waiting for "Sage Technique: Taking over bodies" or "Sage Art: make-up no jutsu" from him, then you are welcome.
−
@Sae, I think we should list Sage Mode as a parent technique to Curse Marks but to Sage Transformation as well, or related/delivered ?
−
IT WAS NEVER STATED THAT HIS ORIGINAL BODY COULDN'T USE IT, LATEST CHAPTER EVEN INDICATES OPPOSITE--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 02:14, July 11, 2012 (UTC)
−
: You don't quite understand, Elvenora (oh, btw, don't insult since I disagree with you). Amaterasu and Tsukuyomi are perquisite techniques of Susano'o, that's why Madara has the,. And no, Curse Seals use Jugo's chakra for them so they can passively absorb natural energy. Answer me this: why even go the Jugo route if Orochimaru himself has Sage Mode?--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 02:38, July 11, 2012 (UTC)
−
::In this very chapter we learn that curse seals use orochimaru's sage mode chakra. The only way Jugo fits into this discussion is that finding the source of jugo's nature transformation abilities is what led orochimaru to the ryuchi cave where snake sage mode is learned.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 02:42, July 11, 2012 (UTC)
−
::: And we also know that Sage Chakra can be formed via what Jugo does. Again, why even bother getting Jugo for his Cursed Seal Template if he could go into Sage Mode on his own? And why don't you guys want to wait for it to actually be used by Orochimaru? --[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 02:47, July 11, 2012 (UTC)
−
CurseMarksdon'tpossess Jugo's chakra, but his enzyme. And I don't understand the last part ... also Jugo doesn't use Senjutsu/Sage chakra, just Natural Energies.
+
(EditconflicttimeSIX)
−
HefoundaboutSageModeafterexperimentingonJugo, the CurseMarks are used to selectpotentialhostbodiescandidates--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 02:50, July11, 2012 (UTC)
+
@SeelentauIdidn'tsaytheyweredifferenttechniques, which is why I also recommended dividing the Myoboku section intoBalanced/Unbalanced, to indicate skill difference. :-P Oh and since the effectsof Sage Mode are directly relevant to thetechnique(axiomatically),they belong here. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 16:10, March3, 2013 (UTC)
−
: Then how does his techniques work if its just Natural Energy? And he went to the Ryuuchi Cave after experimenting on Jugo...and he couldn't get Sage Mode there. Hence why he kept trying to get stronger and stronger bodies. Thus, he isn't a Sage Mode user.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 03:12, July 11, 2012 (UTC)
−
TheCurseMarkworksbycombiningNaturalEnergyandOrochimaru'schakrawithanenzymefromJugo ... it justcreatestransformationandgivesSageMode-like abilitiesdue to SenjutsuChakraofOrochimaru,buttheusersofthesealsaren'tSagesastheyhavenocontrolthemselvesoverNaturalEnergyand arts of Senjutsu,neitherJugoClan'stransformationsareto be considered Sage Modes, becausethere's no control over Natural Energy, justtransformations.
+
@Tau,I'mtalkingaboutJugoandhisclan,theirenzyme isn'tresponsiblefortheirbodilychangesalone, it'sthecatalystthatcausestheirbodiestorespond to naturalenergydifferentlythan"ordinary"peopledo,withoutit,theywouldturnintoastatue.The"bodyaltering"thingisanattribute of naturalenergyingeneral--[[User:Elveonora|Elveonora]]([[Usertalk:Elveonora|talk]])17:21, March3, 2013(UTC)
−
For the last time, it was never stated he couldn't get Sage Mode there.
−
You are both blind and ignorant ... anyways, I'm done with you and I won't reply anymore to you.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 03:30, July 11, 2012 (UTC)
−
: You are both rude and insulting. When could have have gotten Sage Mode if not there? Why did he need to keep getting stronger and stronger bodies if he already HAD Sage Mode?--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 04:07, July 11, 2012 (UTC)
Since he would die one day as an old man, all his efforts would had become meaningless.
−
Thus he need a strong and young body for that, and a one that can hold his greatness, Sage Mode included ... you should know this--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 04:42, July 11, 2012 (UTC)
−
CONCLUSION:
+
I think this one is gonna go down as the longest discussion of this wiki. That aside i'm also in favor of the re-structuring of the article to remove redundancies, at least those that are ability related. Either way since most appear to be in favor, why not just start? [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 22:09, March 6, 2013 (UTC)
−
1.Orochimaru can use senjutsu chakra(regardless if its perfect or not) thus making hin a sage.
−
2.orochimaru branded others with curse seals to test if they're body can survive using natural energy
−
3.Orochimaru apply the curse seal while in sage mode, using enzymes from jugo's body(so they/it will absorb the natural energy for the nonsage users)
−
Am I right?[[User:Saeyatachi|Saeyatachi]] ([[User talk:Saeyatachi|talk]]) 05:12, July 11, 2012 (UTC)Saeyatachi
−
: No conclusion at all. Elveonora, Orochimaru needed stronger bodies to not only become immortal but attain Sage Mode. He learned to use Senjutsu chakra, but not to attain Sage Mode itself, that's what the chapter makes clear. And Orochimaru apply the seal while in Sage Mode? Prove it, he wasn't in Sage Mode when he applied it to Sasuke. Orochimaru isn't a Sage, he just can use Senjutsu chakra. Like how Kinkaku and Ginkaku aren't Jinchuriki, but can use Biju Chakra.--[[User:SuperSaiyaMan|NaruHina fan]] ([[User talk:SuperSaiyaMan|talk]]) 05:30, July 11, 2012 (UTC)
−
whyisthatwhenNaruHinatalksthediscussion tends to repeat? your the only one arguing here?[[User:Saeyatachi|Saeyatachi]] ([[User talk:Saeyatachi|talk]]) 06:10, July11, 2012 (UTC)Saeyatachi
:Since it makes sense that Orochimaru never achieved Sage Mode, given he never, not ''once'' used Sage Mode in the manga and ''none'' of his jutsus even have the Senjutsu moniker. Why wasn't Orochimaru revealed to be a user in the Third Databook when it was released? What sense does having two Sannin having the same power when Pain said 'all the Sannin are unique'? --[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 06:58, July 11, 2012 (UTC)
−
::Actually. It's still possible SuperSaiyaMan, during Asuma's life for example we never saw him use [[Wind Release: Dust Cloud Technique]] but he did so as an Edo Tensei and I'm sure, just like everyone else Orochimaru has techniques that we haven't seen him use. There's also the matter of Kabuto saying his host bodies couldn't manage it and what not. But the fact that he absorbed his own chakra as well as the Senjutsu chakra from Kabuto, says a lot. In any case to me, it doesn't make any sense going on about this with the limited information that we have.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 11:05, July 11, 2012 (UTC)
−
:: It doesn't make sense though. Orochimaru should have gotten some techniques listed as Senjutsu in the Third Databook, and would have been listed as a user there. However, he wasn't. Its premature adding him to Sage and Sage Mode until he actually ''uses'' it. --[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 20:31, July 11, 2012 (UTC)
−
:::And Deidara's techniques should have been listed as kekkei genkai, but weren't. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 22:06, July 11, 2012 (UTC)
−
Databooksdon'trevealeverything,like first one can say that Bob's favorite food is a chicken, and the second his height/weight, third about his background etc.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 22:12, July 11, 2012 (UTC)
+
==improvedchakracontrol?==
−
: Databooks are what is revealed from the author. Orochimaru was still alive/relevant when Sage Mode was introduced. Thus if he had it, he'd have been listed by it. Not to mention he was given a 3.5 in stamina/chakra by Kishimoto...when both Sage Mode users had a 5. Thus, again, until he actually ''uses'' it he isn't a Sage or uses Sage Mode. It isn't the same as Deidara's Blast Release.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 20:11, July 12, 2012 (UTC)
−
::To me, Sage's are persons who can manipulate natural energy (outside of Jūgo's clan). Though I wish Shounensuki was here to ply us with direct translations, Jūgo noted that Orochimaru undid Kabuto's Sage Mode. He would have to have some knowledge in the area to do something like that no? --[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 20:25, July 12, 2012 (UTC)
−
Knowledge is one thing, actually possessing it is another. Kabuto even went so far to say that Orochimaru failed to achieve it due to his weak body. And he canonically doesn't have the chakra for it as well since Sage Mode requires a ''vast'' reserve like Naruto, Jiraiya, and Kabuto. Orochimaru learned enough to form perhaps the minimal amount of Sage Chakra, but couldn't enter the mode and was forced to rely on Jugo.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 20:32, July 12, 2012 (UTC)
−
Kabutohas3(lessthanOro)instamina and is a Sage Mode user,yourargumentisinvalid--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 20:29, July12, 2012 (UTC)
+
Justwondering,wouldn'tanexplanationofNarutobeing capable of creating Rasengan without a clone and in one hand or even two in each at the same time, be a proof of Sage Mode improvingchakracontrolaswell?--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 14:57, March11, 2013 (UTC)
−
: You mean ''before'' all that training, genetic manipulation, and everything that Kabuto did? Orochimaru's stamina didn't improve (especially since he was dead for a significant amount of time) but Kabuto's did, Elveonora.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 20:32, July 12, 2012 (UTC)
−
That's called theory-crafting, only information that's in the disposal is mentioned ... "what ifs" do not belong here, stop already. The conversation has reached it's end for you keep repeating yourself and speculating ... one way or the other, it's too long.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 20:47, July 12, 2012 (UTC)
+
bump--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 17:10, March 12, 2013 (UTC)
−
WowElvenoraeyou'reanass.AtNOpointisitokto call someone retarded. 2majorityruleisBS. NaruHina is right and even if all of you disagree with him, hewill still be right, you guys don't decide the truth no one does not even me. you guys make the rules and completely ignore them. WHEN did oro show sage mode. That's YOUR rule not mine. follow your own damn rules and stop bullying NaruHina.
Notsigningyourposts,that'sasmuchvalidityasyouhave. And no, he/she isn't right and insteadofconversationthatwas supposed to help the article, it changed into theory-crafting, nitpicking, assumptions, delusions and ignorance--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 21:18, July 12, 2012 (UTC)
+
[[SageArt:BigBallRasengan]]and[[SageArt:Ultra-BigBallRasengan]] and [[SageTechnique:SpirallingSerialSpheres]]--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 23:46, March 12, 2013 (UTC)
−
and@Cerez365Ideeplyrespect you. THANK YOU for not being a jerk like elveonora. in your latest comment you said, "To me, sage mode is..." my only issue is the 'To me' part.Aren't youguysfactcheckers, you collect data and put it on here. your job isn't to interpret it is it? This is supposed to be like the justice system innocent until provenguilty, burdenofproof=beyondareasonabledoubt,yourrulesstatethat it must be Shown or clearly stated, neitherofwhichis the case, I believe oro could be a sage but we CAN'T prove it. in court the bad guy gets off sometimes. but that's the price of fairness. and right now we don't have enough info to make such a claim.
:Except we do. And it's not majority rule, either. It's the logical conclusion based on the facts concerning sage mode. Omnibender's post from yesterday should have ended this discussion: From the moment you can balance natural energy with the other two enough so that it's stable, you've made senjutsu chakra, meaning you're in Sage Mode. And sign your posts. [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 21:21, July 12, 2012 (UTC)
−
Jerkssays: allevidenceisthe above, and no one is interested in beliefs and neither this is an elementary school where people bully NaruHina. The majority has agreed on it thus there'snonewevidence for achange.
+
:[[SageArt: Ultra-BigBallRasengan]]:Didn'tseeaclone for thatone.
−
The more ignorant you will be, the more the jerk will let you eat it--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 21:25, July 12, 2012 (UTC)
−
: At Jetdeagon and Elevonora, until Orochimaru actually uses it, he shouldn't be listed as a Sage Mode user. Fukasaku himself said Sage Mode requires a high amount of chakra, like Jiraiya and Naruto. Two of the people who have a 5 in the stat in the databook. While Orochimaru has a 3.5, which isn't enough. Not to mention that again, Orochimaru would have been listed as a Sage Mode user in the Third Databook, but he wasn't. Only Jiraiya. --[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 21:27, July 12, 2012 (UTC)
:[[SageTechnique:SpirallingSerialSpheres]]:Canassumehedidn'thaveaclone,butconsideringwedidn't know he was making the Rasengans until the Animal Path was inside the toad's mouth, wedon't know.
−
: Elveonora, appealing to the majority as well as being extremely rude isn't helping your case. You keep ignoring these actual facts we know about Sage Mode so you can just have Orochimaru have it. Let me guess, it'll make Itachi stronger since he beat a Senjutsu using Orochimaru right?--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 21:33, July 12, 2012 (UTC)
−
Lord this is reallylong._.whenIsaid"tome"ImeantfromwhatIreadontheSageModearticleandinthemanga.Inanycaseweshouldwaitonmoreevidencebeforecarryingonthisdiscussionbecauseitdoesn'tseemtobegoinganywherebuttowardsanargument.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 21:35, July12, 2012 (UTC)
+
::It is alsoworthnotingthatsomeonestatedsomewhereatsomepointthatNarutocouldmakeRasenganswithoutclonesinPartII,butbythatpointjustpreferredtouseclones.ItwasalsostatedatsomepointbysomeonesomewherethatKishimotojustdidntcareenoughtodraw another clones ineverypicture.--[[User:TheUltimate3|'''TheUltimate3''']][[File:Allied Shinobi Forces Symbol.svg|20px]][[User Talk:TheUltimate3|<sup>(talk)</sup>]] 00:08, March13, 2013 (UTC)
Niceexplanation,thenperhapsweshould remove/change some instances that mention he can't duetopoorchakracontroland stuff. Actually his chakra control has become very good by now, so it even makes sense that it's simply his style, not limitation, if we have references, that's it. I think he did in anime or movies, but that's not much canon, but perhaps could serve enough--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 00:15, March 13, 2013 (UTC)
−
Your logic is like that of a 12 years old, god even mixing Itachi and "vs" factor into it ... common troll stuff--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 21:38, July 12, 2012 (UTC)
−
@Jetdeagonokthen I'mresolved:)Thankyou.
+
Theoneissue I havewithUltra-BigBall one is that it was done in the mindscape, not actual real world. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 01:07, March 13, 2013 (UTC)
−
::Elveonora, stopcallingmeorotherpeople'retarded'.You aren'thelpingyourcase.And'common troll stuff', itssomething people are motivated for lately. Again,what's wrongwithwaitinguntil he actually USES it, Jetdeagon, Elveonora? --[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 21:41, July12, 2012 (UTC)
:::Because your argument is flawed. You admit he can use senjutsu chakra but not sage mode, when in reality the moment you create senjutsu chakra you ARE in sage mode. That is exactly the same as saying someone who uses Lava Release shouldn't be listed as a Fire Release user until they use a Fire Release technique.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 21:44, July 12, 2012 (UTC)
−
:: But having Senjutsu chakra isn't enough. Its implied that it was via his cursed seal. Again, why would he even need Jugo's enzyme if he himself had achieved Sage Mode? And Kabuto even said he tried, and failed when he went to the Cave...''after'' researching Jugo. And to actually have Sage Mode, you have to have a monstrous amount of chakra. --[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 21:50, July 12, 2012 (UTC)
−
How do you want me to take you seriously and not to insult you while you ignore everything that's being stated in manga and replacing it with your flawed version of ... logic? I don't think that's even a logic.
−
His Cursed Seals posses his Senjutsu chakra and he has absorbed his power from Kabuto, thus can use Sage Mode.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 21:48, July 12, 2012 (UTC)
−
: His cursed Seals use Senjutsu Chakra because of Jugo. And insulting people isn't a way to get your argument across and you know it. We know that Sage Mode requires a high amount of chkara. Orochimaru doesn't have a high amount of chakra. Its simple as that. Until he actually uses it, he can't be called a user.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 21:50, July 12, 2012 (UTC)
−
−
Jugo doesn't use Senjutsu chakra ... a usage of natural energy =/= always a sage mode, a control over/manipulation of natural energy and forming of senjutsu chakra = sage mode.
−
Also Kabuto has proven your argument invalid, and Oro did control senjutsu chakra so stop repeating yourself already--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 21:54, July 12, 2012 (UTC)
−
:: Jugo uses Sage Transformation to passively absorb Natural energy. It'd be easy for someone like Orochimaru to balance that with chakra to make it Sage Chakra. And no, Kabuto, who had improved since then, doesn't disprove it. You need a massive amount of chakra for Sage Mode, which Fukasaku says.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 21:58, July 12, 2012 (UTC)
−
−
Sage Chakra = Senjutsu = Sage Mode O_O are you even listening?
−
And your Kabuto case is only "maybe, what if, he must have" etc. no solid facts only assumptions--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 22:03, July 12, 2012 (UTC)
−
: http://www.narutobase.net/manga/Naruto/412/11 Straight from Fukasaku's mouth: "You have to have enormous amounts of chakra, otherwise you won't be able to draw out Nature's Energy. That's how great it is." Orochimaru doesn't have enormous amounts of chakra. And how is fighting for two days straight not proof that Kabuto has gotten a stamina increase? Orochimaru worked around his inability to draw Nature Energy using the Cursed Seals and Jugo's enzyme.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 22:06, July 12, 2012 (UTC)
−
−
Anyone want to kindly explain why this one section is taking up half the talkpage ? >_< --[[User:Speysider|Speysider]] <sup><small>[[User_talk:Speysider|Talk Page]] | [[User:Speysider/Images|My Image Uploads]] | [[User:Speysider/Tabber Code|Tabber Code]] | [[w:c:supersajuuk|My Wiki]] | [http://youtube.com/user/SuperSajuuk Channel]</small></sup> 22:05, July 12, 2012 (UTC)
−
:SuperSaiyaMan simply refuses to accept facts.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 22:06, July 12, 2012 (UTC)
−
−
I would said aliens, bit it's NaruHinaSuperSaiyMan Mega ignorant troll syndrome--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 22:07, July 12, 2012 (UTC)
−
: Oh, I'm a troll because I'm following the rules set for Sage Mode that the manga set down? Bringing up multiple sources where Orochimaru could have easily been made as a user but wasn't? 'Mega Ignorant Troll', more like someone who wants to preserve the validity of the article. Manga flat out says that only people like Naruto and Jiraiya can use Sage Mode due to their high chakra levels. Orochimaru was given an above average chakra level by Kishimoto himself, making him inable of actually using it. What's wrong with a little patience and waiting for more information like ''we are supposed to?''--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 22:17, July 12, 2012 (UTC)
−
−
I think for everyone's benefit that this discussion stops as we have insults being thrown around in every message. I'm heartily sick of being spammed notification emails about this talkpage now =.= --[[User:Speysider|Speysider]] <sup><small>[[User_talk:Speysider|Talk Page]] | [[User:Speysider/Images|My Image Uploads]] | [[User:Speysider/Tabber Code|Tabber Code]] | [[w:c:supersajuuk|My Wiki]] | [http://youtube.com/user/SuperSajuuk Channel]</small></sup> 22:19, July 12, 2012 (UTC)
−
−
@dude, there's nothing to wait for. He has already used it, that's why he is listed. He is yet to use a named Senjutsu technique though, for sure.
−
Anyways, isn't it time for an archive already?--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 22:23, July 12, 2012 (UTC)
−
: Except he kind of didn't. He used Senjutsu chakra...through something made specifically to help with that. Cerez said we should wait until there's more information.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 22:26, July 12, 2012 (UTC)
−
−
You are ignoring passages of text and are speculating, but whatever ... I'm done now.
−
Also it isn't necessary to spam other user's talkpages about the issue as they should be posting their opinion on this here. Closing this down, making a continuation--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 22:46, July 12, 2012 (UTC)
−
−
== as of latest chapter - continuation ==
−
−
Opinions, no wars ... edit: mostly from users that are yet to say a word on the issue--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 22:50, July 12, 2012 (UTC)
−
: Fukasaku said that Sage Mode requires enormous amounts of chakra, which is why Naruto and Jiraiya could learn it. Orochimaru doesn't have massive amounts of chakra, having only a 3.5 in the databook. Jugo's Sage Transformation gives him a work around so he can use Sage Chakra without having massive amounts of chakra, hence why he was able to use Sage Chakra to observe while within Anko's seal.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 23:30, July 12, 2012 (UTC)
−
::"Sigh"...i don't remember seeing a talk page topic being this long since the whole Jiraiya being stronger than Itachi thing months ago...and here i thought people were losing interest in the wiki...xD. Now seriously speaking...re-analyzing previous chapters and combining that with the recent information, i believe that Orochimaru has learned how to use sage mode/senjutsu...but i am against saying he fully mastered or controled it...his lack of usage in '''major battles''', plus the statements done by both Kabuto and Fukasaku all together inply that Orochimaru at least didn't master Sage Mode for a viable use in battle, hence why he likely experimented on Jugo and created the Cursed Seals...likely his mastery of it was lesser than Jiraiya's and the fact that his host bodies couldn't withstand it add to that fact. But the fact that with the nature of the Cursed Seals, plus the fact that he not ''only'' released Kabuto's Sage Mode and absorbed the senjutsu chakra does state knowledge of how to use it...thus a very imperfect Sage Mode. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 23:47, July 12, 2012 (UTC)
−
: About releasing Kabuto's Sage Mode, its more like it cancelled out on its own when Orochimaru took his chakra and power away, leaving Kabuto unable to sustain it. --[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 23:56, July 12, 2012 (UTC)
−
::Which is pretty much the same...you need proper knowledge to do either, again going to the fact that Orochimaru has the ability of going Sage Mode. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 00:21, July 13, 2012 (UTC)
−
: Its basically like cancelling genjutsu. Jiraiya sucks at it, but he can cancel it. As for the article, it'd be better for us to wait for Orochimaru to tell Sasuke 'Wait for me, I'll enter Sage Mode' like during a battle. Because as of now, he doesn't have it as far as information goes, not even Jiraiya's version.--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 00:43, July 13, 2012 (UTC)
−
−
Orochimaru's stats in the databooks also reflect his host body. That's why he has such a variation of height and weight between the databooks. His aptitude to jutsu isn't affected because that's a mental capacity, stuff that relies on the strength of the host body would be affected. I find that a logical explanation for why he would be able to use Sage Mode while having 3.5 as stamina, because that's the stamina of the host body, not the he would have learned senjutsu with. I don't know if anyone has brought it up, but Orochimaru putting his senjutsu chakra in the seals when applying them would mean he was capable of using it, at least to a limited extent, in order to brand Sasuke early in the series. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 01:36, July 13, 2012 (UTC)
−
: I thought the stats don't take into account that stuff, especially the physical ones. Orochimaru would have a 3.5 regardless, no matter if his body was up to it. The manga even goes in he failed to achieve Sage Mode. What did Shonensuki say of that scene?--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 03:53, July 13, 2012 (UTC)
−
actually it makes sense...exept for the retarded guy...[[User:Saeyatachi|Saeyatachi]] ([[User talk:Saeyatachi|talk]]) 01:54, July 13, 2012 (UTC)Saeyatachi
−
:...yes, insult. Because you have nothing better. Why can't we just wait? And Omni, why don't you discipline Saeyatachi and Elveonora for their blatant insults?--[[User:SuperSaiyaMan|NaruHina fan/SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 03:53, July 13, 2012 (UTC)
−
Again as i said...if you join the little bits, inplications and the latest information, Orochimaru is Sage and Sage Mode user, but as Omni stated his lack of stamina and/or other flaws makes his SM unviable in battle, which would expalin the reason he created the Cursed Seals in the first place. He may not be capable of using it in battle, but his senjutsu can and was put to other uses. [[User:Darksusanoo|Darksusanoo]] ([[User talk:Darksusanoo|talk]]) 02:41, July 13, 2012 (UTC)
−
−
okay...i take back what i've said..sorry...but let's end this discussion.let's just wait for the next chapters...i bet that would explain things..okay?[[User:Saeyatachi|Saeyatachi]] ([[User talk:Saeyatachi|talk]]) 05:24, July 13, 2012 (UTC)Saeyatachi
−
:Yeah, lets wait. We want to be absolutely sure before we add Orochimaru as a Sage Mode user. We don't want to make a mistake.--[[User:SuperSaiyaMan|SuperSaiyaMan]] ([[User talk:SuperSaiyaMan|talk]]) 07:10, July 13, 2012 (UTC)
−
−
When a section becomes as big as this as fast as it did, my fine-combing becomes less fine. Between this and the message I see you left in my talk page, which I have yet to read, I'll go into detail. [[User:Omnibender|Omnibender]] - [[User talk:Omnibender|Talk]] - [[Special:Contributions/Omnibender|Contributions]] 19:32, July 13, 2012 (UTC)
−
−
I have nothing against Sage Mode being removed from his infobox, but at least it should be mentioned in abilities section that he has some control over senjutsu, to let people make their own opinion of that till the manga shows him using it if that's BIG of an issue ...--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 20:56, July 13, 2012 (UTC)
−
−
As I recall' Kabuto specifically mentioned his host bodies weren't capable of handling Natural Energy, hence Orochimaru didn't ever enter an actual Sage Mode. Absorbing Natural energy =/= entering Sage Mode. [[User:Skitts|Skitts]] ([[User talk:Skitts|talk]]) 02:25, July 14, 2012 (UTC)
It seems somewhat fair to say Orochimaru can use Sage Mode in his abilities and remove it ('Sage Mode') from his info box.
−
However I think it is very silly. This is because Orochimaru uses Senjutsu chakra; Fukasaku clearly told us that only Sages can use Senjutsu chakra. Citing Fukasaku is important because he said this when we were being introduced to the mechanisms of the Sage Mode.
−
−
"Sage" denotes someone who can use Sage/Senjutsu chakra - Fukasaku made this very clear just before Naruto jumped into the toad oil.
−
Basic reading comprehension will tell you this: Naruto was learning how to use Sage chakra; Naruto is about to give up; Fukasaku says only those who don't give up can become Sages. Going by this, to be a Sage you need to control Senjutsu chakra.
−
−
Now bung in that Orochimaru also went to Ryuchi cave... Unlike Kabuto he was unable to become a Perfect Sage. Notice how he (Kabuto) never said anything remotely like "Orochimaru was unable to become a Sage like me", he said "true/perfect". That was a big deal when it came out, Sage Orochimaru was never considered as we never saw him. Till we were told he uses Senjutsu chakra.
−
−
To be honest, with all the information we have: I think the info boxes really should link Orochimaru and Sage Mode.
−
One thing to note is we arguably have a feat point towards Sage Orochimaru. Chapter 290, how did Orochimaru know that team 7 were hiding in the bushes? We don't have him listed as a chakra sensor- but Sage Mode sheds light onto it.
−
−
If you really wanna, you can think of it like this:
−
Orochimaru is an imperfect Sage because he looks snake like; Kabuto is a perfect Sage because he looks like a dragon.
−
−
In short: I think Sage Mode and Orochimaru should be linked, because we have a wealth of info pointing towards it. --[[User:Jingo12|Jingo12]] ([[User talk:Jingo12|talk]]) 22:47, July 16, 2012 (UTC)
−
−
I agree, except Oro not being a perfect Sage. When he absorbs his own chakra/senjutsu chakra from Kabuto, his hands gets scales like Kabuto's but turns normal afterwards, indicating he has a complete mastery over it unlike Kabuto, as the latter had physical transformation. I think people take the "dragon" like too literal, Kabuto could refer to overall abilities--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 23:12, July 16, 2012 (UTC)
−
−
Not quite. Juugo in many translations - Mangateers; Mangastream; Mangapanda; Yagami1211 (Narutoforums); and Geg (Narutoforums) - explicitly says that Orochimaru released the Sage Mode prior to absorbing his own chakra from Kabuto. Kabuto did take a lot of Orochimaru chakra from Anko.
−
Anko also had that sort of scaly look when she had some of Kabuto's flesh.
−
−
Kabuto was very clear when he said Orochimaru couldn't find the body to bear the ability (Sage Mode) and couldn't become a *perfect* Sage. Orochimaru can use Senjutsu chakra and Kabuto made a deal about going from a human, to a snake, to a dragon. And we can clearly say Orochimaru stagnated at the 'snake' stage.
−
−
Whereas Kabuto's jutsu indicate 'dragon'. It makes more sense when you think of the Chinese dragon whom sort of has a snake-like body, but with the legs; best shown via Kabuto's White Snake form and Manda 2.
−
−
Kabuto said a perfect Sage Mode was how he was able to completely surpass Orochimaru. If anything that does *not* suggest that Orochimaru "has a complete mastery over [Sage Mode]".
−
Especially when you consider Orochimaru undid the Sennin transformation prior taking his own chakra back.
−
−
The only issue is: we don't know if Orochimaru has yet to show us his Sage Mode, or if he's constantly been in Sage Mode.
−
However I am sure of one thing: he doubtlessly has it; the information we have access to does suggest so.
−
−
---
−
−
On side note regarding the issue overall:
−
−
"Another way is to study under snakes from the Ryūchi Cave where Orochimaru and Kabuto Yakushi learnt it." - from the Sage Mode article. It makes no sense to *not* have Orochimaru on the info box with this line here.
−
−
"At some point, Orochimaru began researching the source of Jūgo's powers and uncovered the Ryūchi Cave, where he and later Kabuto Yakushi learned Sage Mode"
−
- From Orochimaru's article. It makes no sense *not* to have Sage Mode on Orochimaru's info box with this line.
−
−
Considering these why should we say Orochimaru has Sage Mode, yet disregard those bits in the respective articles by not acknowledging them on the relevant info boxes?
−
−
--[[User:Jingo12|Jingo12]] ([[User talk:Jingo12|talk]]) 14:29, July 17, 2012 (UTC)
−
−
Ask NaruHina, his voice is gospel--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 15:11, July 17, 2012 (UTC)
−
−
It is in fact true that that statement makes no sense if we're staving off the addition of Orochimaru to the technique. That will be fixed along with all the other things that "don't make sense not to have..." I must say I'm proud of SuperSaiyaMan, generally he has some way-off interpretations of chapters, but this time he stood his ground and argued his point well (from what I read, all of this is prime tl;dr stuff) and seeing that this is what the community has decided, adjustments just have to be made. All will be revealed/confirmed eventually.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 16:24, July 17, 2012 (UTC)
−
−
Having said that, out of my walls of text, while discussing the adjustments I feel that Orochimaru using Senjutsu chakra should be considered. Having read the arguments, I took it upon myself to go and re-read quite a number of chapters. No-where did I find - facts, interpretations, hints etc - that it was at all possible to use Senjutsu chakra without having the Sage Mode.
−
−
---
−
−
About NaruHina fan's - aka SuperSaiyaMan - stance there is a number of things I found wrong with his premise.
−
First and foremost, where he mentioned boldly that "Kabuto explicitly said Orochimaru tried learning Sage Mode, but couldn't achieve it"; with my re-reading I didn't come across anything like that.
−
I only saw Kabuto saying unlike himself, Orochimaru was unable to become a perfect Sage. In a similar vein you can say unlike Naruto, Jiraiya was unable to become a perfect Sage.
−
That aside, Orochimaru making use of Senjutsu chakra is a large red light to over look. Even imperfect Sages are capable of using Senjutsu chakra, the best example being Jiraiya.
−
−
Further NaruHina fan also relies on the "Orochimaru hasn't shown Sage Mode" stance. That is a fair stance, though we also have to consider that we've never seen Orochimaru go in an all out battle in the same way some other characters - like Jiraiya - have.
−
−
There are other things like in the first talk (prior the continuation) where he made the assertion that Orochimaru's original body couldn't handle the Sage Mode. I saw nothing implicating the original body, I saw things implicating the host bodies, however. Hence the "he couldn't find a body"; that can be taken as Orochimaru couldn't go Sage Mode, period. Though, as I said him using Senjutsu chakra is a large red light to overlook.
−
−
Another thing I noticed was TheUltimate3's line: "Gathering natural chakra is one thing, but actually entering Sage Mode is another." From what I gathered, the former is completely dependent on the latter; you cannot form Sage chakra without Sage Mode.
−
−
In all, I agree he did well standing his ground. However if I thought he argued the point well, I wouldn't be contesting it.
−
In all I really think the actual fact it boils down is we haven't seen Orochimaru use the Sage Mode.
−
−
Regardless of opinions, I think the articles need a definitive stance. We can't say that Orochimaru is a user in the articles, but not acknowledge it on the infoboxes. Needs to be he is, or isn't- but you acknowledged that, Cerez365.
−
−
I dunno about you, but personally I didn't see anything about the community as a whole agreeing on this (mind you, I've only seen the Sage Mode talk page). It still seems to be debatable.
−
−
Perhaps a good fix could be listing Orochimaru as a Sage Mode user in the info boxes but putting "(presumably)" next to it. As it was done with Sasuke and Tsukuyomi for some time, long ago.--[[User:Jingo12|Jingo12]] ([[User talk:Jingo12|talk]]) 17:28, July 17, 2012 (UTC)
−
−
I believe as they stand, the article state what we know: Orochimaru has used Senjutsu and not Sage Mode. Because the two are so closely linked and he isn't Jūgo nor any of his clan members it is inevitable that the information is going to get crossed in the process which is in part due to the fact that it isn't any one person editing the article at all times. I personally believe that Orochimaru is able to use Sage Mode, hell I at times hope/think Tsunade can do the same, but it isn't all the time that we're going to be able to represent everything any one person wants, which is why we wait for more concrete evidence before moving forward.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 19:00, July 17, 2012 (UTC)
−
−
Speaking of concrete evidence, I must ask: what evidence suggests one can use Senjutsu chakra without Sage Mode? Notably evidence which shows you don't need to be a Sage to use Sage chakra.
−
I'm finding it a hard to readily accept the community notion without fully understanding the rationale behind it.--[[User:Jingo12|Jingo12]] ([[User talk:Jingo12|talk]]) 01:03, July 18, 2012 (UTC)
−
:And I find it hard to readily accept that one single persons' relentless opposition to everyone else constitutes "community notion". [[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 04:19, July 18, 2012 (UTC)
−
−
Exactly, since when is one person the "major opposition" that's butt-licking. I thought the majority decides upon something, so how is the word of one person final now?--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 11:34, July 18, 2012 (UTC)
−
−
Sorry to bring this up again, but I really think this should be addressed.
−
Firstly because there are members who don't believe this was a community decision.
−
−
Lastly because of the fact that this article would probably confuse readers of this wiki: Orochimaru is classed as a 'Sage' in his article, the Sage Mode and Ryuuchi Cave articles that Orochimaru learnt Sage Mode. Yet the Sage Mode info box doesn't acknowledge this.
−
Think of it from a reader's perspective: you read Orochimaru has Sage Mode in different articles, yet Orochimaru isn't listed as a user on the infobox of Sage Mode? It would be rather puzzling.
−
−
That's the reason I reckon these adjustments that Cerez spoke of should be made soon.
−
−
Now I about my stance, I'll say the: about the "Orochimaru hasn't shown Sage Mode" stance, we haven't seen Fukasaku and Shima use it, yet we've put them there on the infobox. Using the same line of logic, you can easily put Orochimaru's names.
−
−
Second, surely it should be enough to know that Orochimaru has actually learned Sage Mode (according to the articles on this wiki) to list him under 'users' on the infobox.
−
−
Lastly (linking to the point above), for the sake of consistency it would be better to add Orochimaru as a user. It would flow well with the other articles.--[[User:Jingo12|Jingo12]] ([[User talk:Jingo12|talk]]) 19:02, July 22, 2012 (UTC)
−
−
People assume that when someone has not been seen using a technique, he/she can't do it ... like people thought that Itachi used his whole "arsenal" against Sasuke during their fight, only to pull out extra techniques from his arse when reincarnated. Sage Mode requires to stay calm in order to gather natural energy (with the exception of Kabuto) or to have summons to do it for the user ... we haven't seen Orochimaru fighting much, only "playing" with Sarutobi only to pull Edo Tensei as his card, then against Naruto/Kurama and I bet there wasn't any time to sit and concentrate during that ... neither in his "deathbed" during Sasuke fight.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 20:02, July 22, 2012 (UTC)
−
−
Not to mention the fact that even if we haven't seen it from him, that doesn't nullify the fact that from the moment you can balance natural energy with the other two enough so that it's stable, you've made senjutsu chakra, meaning you're in Sage Mode. (quoted from Omni). We ***know*** he can create and use senjutsu chakra which means he can use sage mode. Not listing him would be akin to not listing Mei Terumi as a Fire Release user since we haven't seen her using a fire release technique. We ***know*** she can use fire release, but she hasn't used one so why list her? it's the same thing.[[User:Jetdeagon|Jetdeagon]] ([[User talk:Jetdeagon|talk]]) 20:21, July 22, 2012 (UTC)
−
−
I agree. I also would like to add that we should carefully consider the Fukasaku and Shima thing: we know they use Senjutsu- but we've not seen them officially use Sage Mode. Yet we list them as users of Sage Mode.
−
−
In a similar vein, we know Orochimaru uses Senjutsu and has used (putting the Curse Seal on people) Senjutsu. Thus we can easily put his name on the infobox just as we have with Fukasaku and Shima.--[[User:Jingo12|Jingo12]] ([[User talk:Jingo12|talk]]) 22:14, July 22, 2012 (UTC)
−
−
== Snake Sage Mode and Markings ==
−
−
Something just crossed my mind. Are we sure that the markings around Kabuto's eyes weren't there before he entered Sage Mode? Mayhaps that's how they are on Orochimaru as well? I was wondering because the way it's mentioned makes it sound as though the markings extended because of the mode.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 10:43, July 27, 2012 (UTC)
−
−
We don't know, it's likely that Snake Sage Mode users have the same snake-pupils and markings around eyes, but Orochimaru was like that since child, thus we confusion and lack of information.--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 15:43, July 27, 2012 (UTC)
−
−
== 5 minutes ==
−
−
Shouldn't it be stated that Sage Mode can only be maintained for five minutes? Fukasaku did say this to Naruto in chapter 420.--[[Special:Contributions/98.109.95.216|98.109.95.216]] ([[User talk:98.109.95.216|talk]]) 01:55, October 22, 2012 (UTC)
−
−
== vagueness ==
−
−
The article says:
−
* There are numerous advantages while using toad Sage Mode. These include:
−
# The user's physical strength, speed, stamina, reflexes, and durability dramatically increase.
−
# The user's ninjutsu, genjutsu, and taijutsu become more powerful.
−
# The user can harness the natural energy surrounding them, turning it into an extension of their body, which increases the reach of their attacks.
−
# The user gains the ability to sense chakra around them.
−
Then:
−
* There are numerous advantages granted while using snake Sage Mode. These include:
−
# The user's perception abilities, reflexes and speed dramatically increase.
−
# The user's ninjutsu becomes more powerful.
−
# The user gains further access to snake anatomy, such as their brille, which can be used to lock out light as well as stop visual-based genjutsu from affecting them.
−
# They are also able to perform abilities that are characteristic of snakes, such as dislocating their jaw, although this is not exclusive to this mode.
−
−
To begin, both should be identical. It's the very same concept only taught from different animals... both use natural energy.
−
Toad Sage Mode provides increased perception too, it's the very same thing as the sensing chakra around them one, thus TSM point 4 and SSM point 1 advantage 1 are the same.
−
Snake Sage Mode also obviously increases physical strength, stamina and durability.
−
I don't see why with SSM genjutsu and taijutsu shouldn't also become stronger.
−
The anatomy part also isn't a power, Kabuto simply got snake eyes just like Naruto gets toad eyes. That would be like listing Jiraiya's toad limbs as a power.
−
−
I vote for a reformulation... "Advantages" part should be a single section, the same with "Forms" with pictures and a short note about the difference of looks.
−
−
Not to mention Frog Kata isn't a part of Sage Mode... it's like other senjutsu techniques from [[Mount Myōboku]], only a senjutsu Technique very likely unique to toads, just like [[Sage Art: Inorganic Reincarnation]] and [[Sage Art: White Rage Technique]] are taught by snakes.
−
EDIT: the jaw part should also be removed as it's not an ability granted by sage mode--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 18:35, November 26, 2012 (UTC)
−
−
If I'm not mistaken we've been over this when "snake" Sage Mode was introduced. Not because they are both Sage Modes mean that everything taught by the snakes is taught by the toads, but, at the same time the reverse can be true. What is written in the article is what we know, not what we assume should be obvious to everyone. At no point during its use did I see Kabuto shown any form of enhanced strength, stamina, or durability. So how can we just assume it?
−
−
As for the other part, technically every senjutsu is a part of Sage Mode. Based on its definition, you cannot manipulate senjutsu without going into Sage Mode or Sennin Transformation in Jūgo clan's case.--[[User:Cerez365|Cerez<small>365</small><sup>™</sup>]][[File:Hyūga Symbol.svg|20px]][[User talk:Cerez365|<sup>(talk)</sup>]] 19:09, November 26, 2012 (UTC)
−
−
Exactly, not everything taught by snakes is also by toads, that's why I said the "sage techniques/arts" differ, but there's only one Sage Mode. Take into consideration both logic, and that both use the same workings of absorbing natural energy around, and that there NEVER was a mention of "snake sage mode" nor "toad sage mode" only Sage Mode... the terms are made up by us the community just to distinguish them while there's no difference outside looks at all. Also since when blocking a sword with hands isn't a proof of strength? At what point did Naruto show increased stamina in the mode? He has PLENTY of that even outside of it, so this one is hard to portray. There was no sign of being low on chakra or exhaustion on Kabuto. Cursed Seals give the same enhancements as Sage Mode, durability included... what more "proof" do you need?--[[User:Elveonora|Elveonora]] ([[User talk:Elveonora|talk]]) 04:37, November 27, 2012 (UTC)
If you look at Kabuto's Sage Mode, it's impossible to distinguish between:
the actual Snake Sage Mode
Juugo's abilities
Orochimaru's abilities
Suigetsu's abilities
Karin's abilities
Kabuto's sensing prowess is a combination of Sage Mode and Karin's abilities. Kabuto's healing is a combination of Orochimaru's and Karin's abilities. The ability to change your body exists with Juugo's, Orochimaru's, and Suigetsu's abilities. The way Kabuto looks is a combination of Sage Mode, Juugo's DNA and Orochimaru's DNA.
Given all that, wouldn't it be a much better idea to get rid of the heading "Snake Sage Mode" and use the heading "Kabuto's Sage Mode"? You could even extend it to the whole article:
General description of Sage Mode
Description of Jiraiya's Sage Mode
Description of Naruto's Sage Mode
Description of Kabuto's Sage Mode
It would also make it easier to turn the lists in this article into proper paragraphs.--Joolushko Tunai Fenta Hovalis (talk) 18:09, December 15, 2012 (UTC)
As of my topic above, I disagree completely with the article the way it is now. Also Kabuto's sensing prowess being partially from Karin? Now then, that's a speculation. The way I get it, the only reason why Kabuto has physically changed is due to Orochimaru's DNA + Sage Transformation.
And again, both Sage Modes grant equal advantages, there are no such things as "toad sm" and "snake sm" mentioned in the series--Elveonora (talk) 20:59, December 15, 2012 (UTC)
I saw your topic. We both agree that the article in its current state is bad. We agree that there is no such thing as Snake Sage Mode. And I think you agree with the structure I proposed, because you mentioned something similar.
About Karin. We know that Karin is good at sensing. We know that Kabuto has Karin's DNA. We don't know whether that influences Kabuto's sensing prowess in Sage Mode. It's just an argument against calling it Snake Sage Mode, and in favour of calling it Kabuto's Sage Mode.
The article in its current form has 12 section headings for the main content! It has general information listed under Toad Sage Mode. It has irrelevant information listed in the usage section. It might as well not have an introduction. It mentions advantages in three sections. It mentions disadvantages for Toad Sage Mode that are actually disadvantages for everyone. It's a mess.
It also ignores that we have essentially seen 4 different versions of Sage Mode. The basic one is the one we see when Fukasaku trains Naruto in Frog Kata, and has the disadvantage that you run out of sage chakra. That problem can be solved by fusing with Fukasaku and Shima as we've seen with Jiraiya (the 2nd version of Sage Mode). Naruto solves the problem with Shadow Clones, making it the 3rd version. Kabuto solves it with Juugo's DNA, making it the 4th version. But wouldn't guess that from the way the article is written.--Joolushko Tunai Fenta Hovalis (talk) 22:05, December 15, 2012 (UTC)
That is incorrect. You're looking at Sage Mode as changing to a different version based on how it's used, but that's not right. We don't know about the Snake version of Sage Mode, , imperfect and perfect. Ma and Pa on your shoulders is just them using Amphibian Sage Technique to sit on their shoulder. That is not a different version of Sage Mode.
Also, having subsections is not a problem. We are an encyclopedia, we chronicle information. If that information requires heading sections, then it gets heading sections.--TheUltimate3(talk) 16:17, December 16, 2012 (UTC)
What Fukasaku explains about Sage Mode; what the difference is between perfect sage mode and imperfect sage mode; it's all applicable to Snake Sage Mode, because we haven't been told otherwise. They're all simply Sage Mode. Kabuto uses the benefits of Sage Transformation to overcome the same problem for which Naruto used Shadow Clones.
Sage Mode on its own is only useful if you want to rearrange the stone statues of toads. Or if you can prepare Sage Mode in advance; ambush your enemy; and defeat him quickly before you run out of Sage Chakra. So yes, Sage Mode+Amphibian Sage Technique is a different version of Sage Mode, because it's far more practical than Sage Mode on its own. Without solutions like Amphibian Sage Technique, Shadow Clones and Sage transformation, all that's left of Sage Mode is an incomplete technique. So it's not just different uses; it's an incomplete technique with 3 different ways to make it complete.
So you're saying that heading sections like "advantages" and "disadvantages" are required? You're saying that headings that use the phrase "Snake Sage Mode" are required; even though that's not canon? You're reply ignores the basic fact that sections shouldn't be used if you only have one paragraph of information.
In the end this article shows that you can't keep adding information to it and hope it remains making sense. Sometimes you have to reorganise the information.--Joolushko Tunai Fenta Hovalis (talk) 20:19, December 16, 2012 (UTC)
Mistake number 1: Assuming things are the same when we are not told otherwise. We don't assume when we aren't told.
Mistake number 2: No, Sage Mode + Amphibian Sage Technique is not another version of Sage Mode. It's Sage Mode with two old toads merged to your shoulder. Naruto could go Sage Mode perfectly well by remaining still and gathering natural energy. The entire point of the two toads was so one can do so in combat. Naruto has gone into Sage Mode on and off perfectly multiple times during the war without the need of a clone (or just a clone of him do it instead of his actual body), still perfect Sage Mode.
Clarification number 1: If they are required, then yes. They could also be moved into paragraph format, but I feel it's easier to have them in a listed format, that way one wants to know what the disadvantages of Sage Mode is, one just has to go to the article, click the header for disadvantages, and wow look there it is.
In the end, the issue I'm having is your belief that there are random versions of Sage Mode when, as of now, we are aware of there only being two and that's the difference between Toad and Snake. Yes, while the name may not be canon, the fact that a perfect Snake Sage has different properties than a Toad Sage is notable (Naruto is a perfect Toad Sage, the only differences is the pigment around his eyes. Meanwhile Kabuto is a perfect Snake Sage, and he gained a lot of snake features.)--TheUltimate3(talk) 20:42, December 16, 2012 (UTC)
@Ultimate, those are physical/visual differences, there are none in benefits. Also the former might be only due to sage transformation/jugo's dna/orochimaru's dna and not a common result--Elveonora (talk) 21:10, December 16, 2012 (UTC)
@TheUltimate3
Mistake 1 = Assuming things are different when we have no information that says otherwise. Which means we can only look at what the manga has given us, and that's ONE Sage Mode.
Mistake 2 = The whole point of Sage Mode is that it's useless in combat UNLESS
you arrive at the battle already in Sage Mode (like Naruto did against Pain); or
you manage to buy yourself some time to get into Sage Mode (like the clumsy toad did for Jiraiya; like the Alliance did for Naruto; and which Kurama's Chakra Cloak did for Naruto)
and even then you have to make sure that:
you either beat your opponent before you drop out of Sage Mode; or
you find a solution to the problem that you can't gather natural energy while moving.
Buying the time to get into Sage Mode is the easy problem. Trying to maintain Sage Mode is the difficult problem, and without a solution it's useless for combat purposes.
Mistake 3 = If you want to see Sage Mode as nothing more than gathering natural energy and mixing it to create Sage Chakra which would lead to Sage Mode, than the article shouldn't need any of the other information. You could pretty much copy and past Fukasaku's explanation to Naruto into this article and lock the page. All the other information should then be moved to the appropriate character pages. If you're going to argue a certain position, at least draw the logical conclusion from it.
Clarification number 1 = We are aware of 3 schools of teaching; 3 schools that teach Sage Mode. We now know that the Toads teach Sage Mode and that the Snakes teach Sage Mode. We were never told that these were *different* Sage Modes. The only thing they might teach different are the ways to use Sage Mode, and their preferred solutions to some of the problems associated with Sage Mode.
Clarification number 2 = We haven't been shown what the Snakes teach. We don't even know how a person that has been taught Sage Mode by the Snakes looks like. What we have seen is the end result of: (a) the Sage Mode as taught by the Snakes; and (b) a shitload of DNA modifications done by Kabuto himself. In fact, Kabuto's Sage Mode could be seen as a hybrid of Sage Mode and Sage Transformation with no answers to questions like: (i) What are the benefits of that combination?; (ii) What are the drawbacks of that combination?; and (iii) How would such a combination change the looks of someone in Sage Mode as taught by the Snakes?.
In the end Kabuto's Sage Mode is exactly the same as Sage Mode+Amphibian Sage Technique but with the added problem that we can't distinguish between the two. You're drawing the illogical conclusion that one is a different version of Sage Mode while the other is not, based on the same facts and using the same arguments. The only thing we know for sure is that perfect sage mode taught by the Snakes will lead to a different pigmentation around the eyes, though we don't know why and how the pigmentation becomes different. We haven't been told that Sage Mode taught by the Snakes will lead to different properties (e.g. speed and strength) in Sage Mode.
What we disagree about is basically this:
Sage Mode = impractical Sage Mode as Fukasaku taught it to Naruto before trying the Amphibian Sage Technique and failing
Sage Mode = impractical Sage Mode plus ways to make Sage Mode usable
I almost completely agree with you, I'd rewrite the article myself, but I don't want to start an edit war. The way it's now is not only incorrect but confusing/misleading.--Elveonora (talk) 01:25, December 17, 2012 (UTC)
Wait for others to chime in on opinions and thoughts. My largest issue with what is proposed is the idea that there are 4 different versions of Sage Mode based on if a toad is on your shoulder or not, but I don't have the patients to continue reading/responding to such incredibly long responses.
Rewriting an article is a bigger task than a single section, wait for others to voice opinions before making a move.--TheUltimate3(talk) 04:46, December 17, 2012 (UTC)
I hope that my analogy to incomplete technique versus completed technique helps with understanding what I mean when I used the word "version".--Joolushko Tunai Fenta Hovalis (talk) 19:11, December 17, 2012 (UTC)
Not really a rewriting, just merging of sections, separating of others, cutting here and pasting there etc. also removal of speculation--Elveonora (talk) 05:16, December 17, 2012 (UTC)
How is this article confusing? I don't know how much this will help but as the article stands now I am fine with it. The only reason it is confusing to you guys is because you're taking things you don't have a clue about and adding them to the mix. It should be:
Sage Mode-Toads
mention all we know
Also make note of the perfect balance and imperfect balance that the two disciples have achieved
acknowledge the traditional method (with a sage toad to aid in process)
also mention the way Naruto uses it (with clones)
Sage Mode- Snakes
Assume that everything Kabuto did then is a product of Sage Mode unless/until mentioned/told otherwise. Then annotations can be made.
All that information is represented on the articles, it's just that you have all gone too far in dissecting Kabuto's Sage Mode. I realise that the people who always have problems with the way articles are, are the ones that go off on tangents and want to jump the proverbial gun and we don't do that here. Once the information is available to us, where we can reference it, and have evidence then that's when we move, not before. I'm not sure if you guys understand or no, but this is a method that has to be used to streamline content on the wikia so we don't lose credibility in the information that is found here.--Cerez365™(talk) 13:05, December 17, 2012 (UTC)
The only thing I could advocate for regarding this page, is that the image in the infobox is no longer accurate and a neutral one, possibly just showing the mixing/balancing of natural energy would be better.--Cerez365™(talk) 13:09, December 17, 2012 (UTC)
@Cerez365...That assumption flies in the face of everything we've been shown in the manga. Kabuto's appearance was already changing when he put Orochimaru's DNA in himself. And everyone that uses a derivative of Juugo's abilities changes his appearance, just like Juugo himself does. Kabuto is using Sage Mode and Sage Transformation together, just like Jiraiya uses Sage Mode and Amphibian Sage Technique together. You can't just assume that everything Kabuto does is the result of Sage Mode, because it's explicitly said that it isn't. Why else would the DNA of Juugo, Karin and Suigetsu be mentioned?
The structure should be:
Sage Mode
Mention all we know (basically everything that Fukasaku explained).
Mention the existence perfect sage mode and imperfect sage mode.
Mention the existence of 3 places where Sage Mode is taught, and that the pigmentation around the eyes show at which place you learned Sage Mode.
Mention that most users have a method of making it more usable in combat.
Jiraiya's Sage Mode
Mention that Jiraiya is an imperfect sage, and that he uses the traditional method as taught by the toads to make Sage Mode usable in combat and refer to the article Amphibian Sage Technique.
Naruto's Sage Mode
Mention that Naruto is a perfect Sage.
Mention that Naruto couldn't use the method taught by the toads and had to come up with his own solution: Shadow Clones (and how he used it in his battle with Pain, maybe).
Kabuto's Sage Mode
Mention that Kabuto learned Sage Mode from the Snakes; that he would therefore look more like a snake than a toad; and that it's unknown how a Sage would look in its pure Snake form.
Mention that Kabuto used Juugo's DNA and Sage Transformation to solve the same problem that Naruto used Shadow Clones for.
Mention how Kabuto infused himself with DNA from Karin and Suigetsu and refer to the relevant section in Kabuto's character article.
That's a far more usable and canon compliant structure than the current article has. It also prevents unnecessary duplication of information (see advantages and disadvantages sections). It also allows contributors to compare a specific character's use of Sage Mode against the general characteristics of Sage Mode, instead of forcing a reader to compare and contrast various uses of Sage Mode against eachother.--Joolushko Tunai Fenta Hovalis (talk) 14:46, December 17, 2012 (UTC)
Kabuto's appearance changed because Orochimaru's cells were fighting to take over Kabuto's body. That has nothing to do with Jūgo. It's akin to Hashirama's cells trying to turn Danzō into a tree, or else have them sprouting his face on his arm and Madara's chest, so you're wrong in that regard.
It's not an assumption, it's lumping all the information together. I did not say they weren't factors into Kabuto's abilities but as this point, we're unable to discern what is what except for what has been told to us:
How do you know that Kabuto is using Sage Transformation and not just using Jūgo's ability to passively absorb chakra? How do you know that that's simply how someone who uses snake Sage Mode is supposed to look?
How do you know that Kabuto's been using Karin's Mind Eye of the Kagura (which is ridiculously impossible to steal via DNA) and just doesn't possess her ability to heal?
There is no such thing as perfect and imperfect Sage Mode. These are terms that we engineered for compartmentalising sake all of which is already mentioned. Ergo, Naruto and Jiraiya's forms don't have to be separated any more than they are now.
Kabuto's:
You're assuming that's not what a "pure" Sage would look like. There's nothing to compare it to, so where are you forming your basis from? SPECULATION
“
Kabuto assimilated the DNA of Jūgo to replicate his clan's ability to passively absorb natural energy, thus allowing him to continuously collect the energy even while moving.
”
Information about the assimilation of DNA unrelated to his Sage Mode is mentioned in his article.
Like I've said before, I personally see nothing wrong with the article's structure and the most I would change is a picture or two. We are supposed to chronicle what is said in the series not the foregone conclusions that we draw on our own.--Cerez365™(talk) 16:02, December 17, 2012 (UTC)
@Cerez365...You're committing quite a few strawman fallacies to "prove" that I'm wrong. Cut it out!
You insist on using the phrase "ability to passively absorb natural energy". Fine, substitute that every time I use the phrase Sage Transformation. It doesn't alter my argument, but you seem to ignore that part in favour of saying that I'm wrong. (BTW, isn't Sage Transformation the name of Juugo's kekkei genkai?)
You acknowledge that there are factors contributing to Kabuto's appearance and abilities. And yet you fail to draw logical conclusions from that; conclusions that are consistent with the manga.
We know how a perfect toad sage looks like: perfectly human except for the pigmentation around the eyes. The logical conclusion is that it's the same for a perfect snake sage. Is that speculation? Perhaps, but the significant part is that it's less speculative than the opposite conclusion (which would be that a snake sage is supposed to look like Kabuto did).
We know that quite a few things that Kabuto assimilated will change your appearance. Sage Mode is just one of several factors that change Kabuto's appearance. The logical conclusion is that we're seeing Kabuto's Sage Mode. The illogical conclusion is that we're seeing "Snake Sage Mode".
The manga says that there are 3 places that teach Sage Mode. The manga doesn't say that there are 3 different Sage Modes corresponding to 3 different animals. The logical conclusion is that there is only one Sage Mode.
The manga is pretty clear about the fact that Sage Mode needs something to make it useful in combat. It's why I referred to Sage Mode as an incomplete technique (as well as to clarify my use of the word "version"). The manga has shown us three ways:
Given this information from the manga, it makes sense to treat the three times we've seen Sage Mode used in combat (the "completed" sage mode) just as important as the ("incomplete") Sage Mode.
You say that: We are supposed to chronicle what is said in the series not the foregone conclusions that we draw on our own.But that's exactly the problem with the current article. Calling it "Toad Sage Mode" and "Snake Sage Mode" emphasizes the personal interpretation of fans. Simply calling it "Jiraiya's Sage Mode", "Naruto's Sage Mode" and "Kabuto's Sage Mode" de-emphasizes any personal interpretation and allows us to emphasize what is actually said in the manga.--Joolushko Tunai Fenta Hovalis (talk) 19:03, December 17, 2012 (UTC)
I see no reason no reason to change the article. It's fine as is for me. Omnibender - Talk - Contributions 21:27, December 17, 2012 (UTC)
@Omni,
the intro is : "Sage Mode is the result of using natural energy along with a ninja's normal chakra to drastically empower all their abilities"
Should be: "Sage Mode is a special technique used by Sages of Mount Myōboku and Ryūchi Cave that empowers their abilities. Another legendary place known as Shikkotsu Forest also exists, but it's yet to appear along with it's inhabitants and a Sage representative"
Also as far as I know, Fukasaku for example isn't a ninja, so theoretically even a samurai could learn it or anyone who is skilled with chakra manipulation for that matter. My version sounds more appropriate as an intro imo.
The part about it's workings should be a solely separate section as there's no need to repeat some of the information twice, and Shinobi again should be changed into user/individual or something.
It's an assumption/speculation:
That Naruto/Kabuto have different power-ups while it's the very same and only technique using the same natural energy from around them, the terms "snake sage mode/toad snake mode" are basically fanon, there's not even a slight hint that there are more versions and that the benefits they grant differ.
That Kabuto uses perfect/imperfect Sage Mode (we don't know even if it's most likely perfect, but since there are other factors as Orochimaru and Jugo's DNA in the play, it should be called Kabuto's Sage Mode) so stating that horns and shit are a sign of a true snake sage is double speculative. EDIT: already changed/removed partially.
So in short, this is how I imagine it:
intro/overview in a nutshell, my proposal
usage/workings/mechanics describing what it is more in detail and containing information about both it's advantages and disadvantages
forms, stating what a perfect and imperfect sages are
users: "Naruto in Sage Mode, Jiraiya in Sage Mode, Kabuto in Sage Mode" with a picture of each representative and a short history about their training and a summary about their "differences and workarounds"--Elveonora (talk) 03:49, December 18, 2012 (UTC)
Strawman fallacies? Friend when you're wrong, you're wrong. Sage Transformation is what happens to the clan members as a result of absorbing the natural energy. Use context clues and figure that out. All I was pointing out was that the info was reflected in the article. And again to address your list:
Both Jiraiya and Naruto's use are mentioned and categorised
Incorrect. The only thing that changed Kabuto appearance was what he took from Orochimaru ergo why Kabuto looked like that when he reabsorbed his "stuff" from Kabuto. If Kabuto had turned out looking like Kevin Levin, you would have had more of an argument. Without even adding the speculation that to think you could absorb a Senju clan descendant and not so much as change hair colour.
The is not one sage mode. There is simple at least three different animals that learned how to absorb, balance and use Sage Mode. Why is this point even here in the first place?
There is no need to me, to mention the different uses of Sage Mode outside said person's section. All the information is represented in the article and it is neither confusing nor lost, and believe me every time something like this comes up I use third party options from people not on the site.
In any case I'm done with this discussion, this seems like another of those lost causes/false alarms.--Cerez365™(talk) 06:22, December 18, 2012 (UTC)
Wood Release Sage Mode/Hashirama's Sage Mode? For the 1000th time, there's only ONE Sage Mode. Why are animal/special labels even needed? It can be sorted into fewer sections.
The article makes it sound and appear like each is a different technique. I'm really not happy with the way it is, as you might have noticed by now (viz above convos)
I will take care of this myself if you don't mind, it almost has fanon content.
The article contains made-up terms and speculation--Elveonora (talk) 13:04, February 20, 2013 (UTC)
As far that can be gathered, each form is different. The First didn't gain any animal traits (frog eyes of Toad, anything of Snake). The article (shouldn't) make it sound like different techniques, but they are at least different styles, hence why they are in one article instead of two or three.--TheUltimate3(talk) 13:31, February 20, 2013 (UTC)
The problem I see, is that the labels are user-made, wood sage mode sounds... weird at least. From what we were told Sage Mode is (state a user enters after successfully combining natural energy with the other two that make up chakra and balancing it equally) the animal-like-traits that differ between users don't necessarily mean a variant. As canonical as it gets, Jiraiya got teleported in the anime to Mount Myōboku because he had "an affinity for toads" (whatever that means, perhaps his personality being reminiscent of a toad) so figure the physical changes have to do with their "affinities" rather than being a variant?
At least the advantages and disadvantages sections should be merged--Elveonora (talk) 13:41, February 20, 2013 (UTC)
Wood Sage Mode sounds just as outlandish as anything else this manga creates, but we aren't calling it that yet. The First's sage mode is different as it has now physical changes that resemble the other two but is mentioned for it. Anyway using the word "affinities" is still basically saying that their Sage Mode falls under different types, except you are using a fancier word.--TheUltimate3(talk) 13:49, February 20, 2013 (UTC)
Even so...from what was gathered so far, all sage modes give a equally broad range of certain abilities...enhanced physical abilities, superior ninjutsu skills, access to senjutsu techniques and access to certain animal traits. Hashirama aside, i believe the distinction between snake and toad sage modes should be erased, since both give apparently equal benefits. Darksusanoo (talk) 13:57, February 20, 2013 (UTC)
I wouldn't say, just to step back a relevant topic or two, Hashirama didn't have any animalistic traits. It could be that we don't know what animal it is. For all we know, it could be the Slug version (which follows the pattern of Frog (Gama) and Snake (Manda)). But that being said, even if not the slug, we still do not know what animal his markings could represent, if they do at all. At this point, we know the only other known sage modes are animals and the pattern suggests it is an animal thing, specifically (at least plot-wise) the summons. And of course "Wood Sage Mode" could be exactly what it is, but we're left with more questions with that as to how and why, and who taught him, versus an animal that can teach him (and what animal). And as for erasing things, I think that is overzealous and foolish going that far into oversimplification simply because of a bias. They are both sage modes, but they are not the same sage mode. If I remember correctly, there is a fallacy that follows that pattern. --98.101.165.89 (talk) 14:04, February 20, 2013 (UTC)
In my opinion, the natural energy transforms them according to what affinity they have. But that doesn't mean each of them differ, why should we list that it gives speed, strength, durability, etc. to every user while it's enough to mention it once for example? If we are listing it like that, then Hashirama's should be nicknamed "Third Eye Sage Mode" or "Buddha Sage Mode" 0_o See? this is why it should be merged and differences noted with pictures alone.
About Hashirama, why does it have to be an animal that taught him it? Perhaps he figured how to harvest natural energy by himself, that would explain the third eye and buddha--Elveonora (talk) 14:07, February 20, 2013 (UTC)
Your opinion natural energy changes them by affinity. What we have seen is that if a Toad teaches you their method of Sage Mode, you run the risk of turning into a giant frog, as did the Preta Path did when it absorbed Naruto's senjutsu chakra.
We don't know what method Hashirama learned Sage Mode. He could be a Wood Sage, he could be a Slug Sage, he could be a Hashirama Sage. That's why it's mentioned that why it's just mentioned that he didn't fit the others.
But I personally grow weary of this discussion, as it is the exact same discussion that is directly over this one. Do what you want I'll edit it the way I feel afterwards if that will make this battle of semantics end. But know this, I will make edits afterwards.--TheUltimate3(talk) 14:17, February 20, 2013 (UTC)
Thanks and I agree, no worries as I don't plan on adding or removing anything (with an exception of something being mentioned more than once), only merging, cutting/pasting so it flows better.
EDIT: but you are right about Pain, he started turning frog as well, hopefully it will be explained in a databook.
About Hashirama, I removed the headline because the section was empty, feel free to make it for him--Elveonora (talk) 14:25, February 20, 2013 (UTC)
@Elv -- Even so, the modes are different and while there are some base similarities, each mode that we know of (Toad and Snake) have more than quit a few differences in what it gives the user compared to the other. It's why I said they're both sage modes, but they're not the same sage mode. Otherwise, they wouldn't even have the animalistic distinction. Or, well, that last parti s my opinion, at least. But regardless, merging would harm them more than help because there's still bits of information that would have to be separated which simply cannot be merged. Not to mention there's no cause for assuming they're the same sage mode. As for Hashirama's -- it could very well be that. But, personally, I don't think we can say either way till we are given the information. Yet going on what we do know about other sage modes...
@Ultimate -- I think, and it is my opinion, it can all be best summed up with a quote from you, "The article (shouldn't) make it sound like different techniques, but they are at least different styles, hence why they are in one article instead of two or three" --98.101.165.89 (talk) 14:26, February 20, 2013 (UTC)
@Elveonora: We'll see.--TheUltimate3(talk) 14:28, February 20, 2013 (UTC)
Well, we shouldn't assume that each variant gives different attributes as absence of evidence is not evidence of absence. If so, then there's nothing to mention in "Hashirama's Sage Mode" because all he did was summon a giant statue, that's no proof of strength, speed, durability etc. and if we do, then we should also list equal feats for Naruto and Kabuto for example, and with that reason in mind, it has to be mentioned just once for all of them. Since a headline with a picture and one line for Hashirama isn't enough, that's why I'm for "advantages" section when all of them are listed with: "Sage Mode among user grants the following enhancements to attributes that might vary slightly"
I kinda imagine it like the Susanoo articles with pictures at the bottom.
I will try to cook something and if yay then yay and if nay then nay--Elveonora (talk) 14:42, February 20, 2013 (UTC)
Well it's not an assumption as Kabuto has listed things that the Snake Mode gave that differs from Toad, IIRC. It is also why I say we shouldn't do anything with Hashi till we know exactly what kind of Sage mode it is. But that sounds fine, we can always edit and fix things to make it better. --98.101.165.89 (talk) 15:10, February 20, 2013 (UTC)
Any examples?--Elveonora (talk) 15:20, February 20, 2013 (UTC)
I seriously don't see a reason for multiple sage modes either. Other than appearance, no one has shown abilities that are different from each other. Also, animal traits only appear on imperfect sages. Otherwise its just pigmentation and the eyes of the animal. (Hashirama's eyes did change. I don't see why people think he doesn't have an animal.) People say that Kabuto said he had different abilities than toad sage mode. Like what? Perceptive abilities? Same thing as Naruto's chakra sensing ability. He totally sensed Sasuke's arrow coming after him. And Sasuke and Itachi when he was blind. Snake eyelid's? Jiraiya proved that one can gain traits of one's animal by unbalancing the natural energy. There's nothing majorly different from any of the sage modes. The general abilities of each should be listed in one section, instead of duplicated like it is. MangekyoSasuke (talk) 17:34, February 20, 2013 (UTC)
"applauds" also Kabuto's messed up jaw and snake eyes aren't sage mode stuff, he had these from Oro's DNA--Elveonora (talk) 17:59, February 20, 2013 (UTC)
Orochimaru himself never displayed any of those. Only thing mouth related I recall Orochimaru doing was puking himself anew and healed. Omnibender - Talk - Contributions 23:20, February 20, 2013 (UTC)
I believe that everyone by now knows that there is only one Sage Mode taught/learnt differently by several other animals/people. With that in mind, this is how the wikia has chosen to represent the information so that all of it is not one giant section. I also do not think we should rush to conclude where Hashirama learned Sage Mode, nor do I believe that his Sage Mode is wood related. They are nothing more than headings based on necessity.--Cerez365™(talk) 23:27, February 20, 2013 (UTC)
I'm going to have to side with Elveonora on this one. The current structure/sectioning of this article is just.... ew, and it seems to make assumptions it shouldn't, case and point: "Senju Sage Mode". O_o For one, ALL that Sage Mode is, is balancing Natural energy with the ninja's Spiritual and Physical energy. That's it. Natural energy doesn't come in different flavours. Kabuto's different appearance could easily be explained by the fact that he took on the DNA of many individuals, most notably Orochimaru, hence the appearance. Also, we don't actually know if Hashirama mastered Sage Mode, though I suppose that's a somewhat reasonable assumption, though if it were up to me we'd hold off on that. Also, Hashi's Senjustu section (in his article) has fluff. *goes to fix* Skitts (talk) 13:57, February 21, 2013 (UTC)
Again, it is established that there is one Sage Mode that is used differently based on how people learn it. These titles are nothing more than a means to differentiate the abilities that persons learn and display. Maybe if the article were to actually mention this, it would be better? You could not expect someone that learned from frog to be using White Rage Technique or a Snake to use Frog Kata, hence everything is not lumped together, but all are in their respective sections. While I am not too certain about the title "Senju Sage Mode" --Cerez365™(talk) 14:56, February 21, 2013 (UTC)
Even with your edits Cerez, the main problem still stays. For example, Frog Kata isn't a part of Sage Mode, it's a senjutsu technique taught by toads. Then there's this perception/sensory thing, viz translation says sensory in Kabuto's case as well, confirmed by Seelentau.
The jaw part, Orochimaru has it as well, just look at his cheeks and the brille part, what does it have to do with Sage Mode? Figure that a man with snake dna has snake eyes even without it? The article is still structured in a way that states that each "animal version" or what **** gives different powers. All Sage Mode users have the same enhancements, be it them dog, cat, boar or whatever animal.
Only unique techniques like Frog Kata or long tongue, turn rock alive or annoying genjutsu sound differ--Elveonora (talk) 18:10, February 21, 2013 (UTC)
I can't agree with that. I've never seen Orochimaru open his mouth like that nor use brille to cover his eyes. People at times seem to forget that Orochimaru is a human being, not a snake. Yes he has a snake form which his body has been "reduced" to but for all intents an purposes, he is a human that uses snake-motif techniques. This is why he was not revived as a snake but with a human body. Kabuto's transformation could easily be akin to Jiraiya purposefully growing frog legs/arms to use in his battle against Pain. There is a general section in the article which mentions what Sage Mode grants a user, though we don't even know that to be true except for the bolstering of techniques. In my opinion, Sage Mode does grant the same basic abilities which is mentioned in the article, but we can't just ignore the person/mode specific abilities. How else would we be able to account for them? --Cerez365™(talk) 18:20, February 21, 2013 (UTC)
I don't share your sentiments, he turned his body into a giant white snake, even tho he can change back at will, his human form is only a leftover of his humanity, for what I would say, he has more snake genes than human genes. Kabuto grew scales when he injected himself, not dark hair. And just because we haven't seen Oro doing creepy jaw thing and protect eyes against visual genjutsu thingy doesn't mean he can't.
He can extend any part of his body with Soft Physique Modification. About Kabuto, even if he changed himself further into a snake purposely, it's not a part of Sage Mode, just like Jiraiya's toad features aren't, turning animal happens when the natural energy isn't completely balanced. About specific abilities, there's link to list of senjutsu techniques down there, it can be expanded with them being actually listed--Elveonora (talk) 19:05, February 21, 2013 (UTC)
Also, Kabuto opened his jaws that wide when he entered slitering snake mode. And again when he swallowed Yamato. MangekyoSasuke (talk) 20:15, February 21, 2013 (UTC)
Pretty much, there's no exclusive things in between them as they all are one and the same. That's like saying shadow clone performed by toad differs from one done by a human--Elveonora (talk) 20:21, February 21, 2013 (UTC)
The problem with the current version is that it implies Kabuto can't do certain things that Naruto and Jiraiya could, rather than leaving it ambiguous. Kabuto didn't actually show whether he can sense chakra like Naruto, for example, but the article's current layout would imply to a reader that he can't. As for unique traits used by Kabuto, there was just White Rage and Muki Tensei, which were specific examples of senjutsu, and possibly his snake brille, but we can't say for sure whether it was from Sage Mode or Orochimaru's white snake DNA. Kabuto was even more snake-like than Orochimaru after all, since he developed scales rather than just pale skin.--BeyondRed (talk) 22:03, February 21, 2013 (UTC)
He did, he dodged Sasuke's arrow without looking and commented on sensory ability.--Elveonora (talk) 23:02, February 21, 2013 (UTC)
I took that to be the same as Naruto's enhanced perceptiveness allowing him to dodge the Third Raikage's attack in Sage Mode, but both might be applications of the general sensory ability.--BeyondRed (talk) 00:01, February 22, 2013 (UTC)
All I'm going to say at this point is, I will not have information lost, because it's stupid to lose information for no reason.--TheUltimate3(talk) 00:13, February 22, 2013 (UTC)
To this discussion, i'm forced to agree that there is only one Sage Mode. As far as i see it all users of it have displayed equal benefits all around. Let's see:
Enhanced physical and perceptive abilities - Check
Increased potency of all ninjutsu, genjutsu and taijutsu - Check
Gained sensory capabilities - Check
Partial animal shape-shifting abilities - Check
As for the dissadvantages we already known those, since it's universal...to me the only difference lies in which sage trains you, but the general abilities all appear to be the same...Darksusanoo (talk) 21:44, February 22, 2013 (UTC)
Of course there's only one Sennin Mode. Why would there be more? The Sennin Mode is the state of having natural energy in your body, you don't even need to have control over it (like Jiraiya). But I still think we should differentiate the different teachers of the Sennin Mode and how the user looks different depending on who trained him. Seelentau 愛議 21:51, February 22, 2013 (UTC)
But the whole problem of this discussion is that...by the way the article is constructed...outright states, that each Sage Mode (Toad, Snake, Slug?) is it own, with different gains and losses, while the three known examples (Jiraiya, Naruto, Kabuto) have displayed near identical benefits. The only actual difference seems to rely on the influence of the animal sage that trains the user, but in practical, combat terms it maybe all the same. Darksusanoo (talk) 22:01, February 22, 2013 (UTC)
Well, who is to say they are even actually the same? All can be sage modes, but not be the same thing, as I mentioned earlier. We have plenty of cases of "All A are B but not all B are A", etc. It's one of the principles of logic, and of course has a fallacy to go along with it. It also doesn't make sense that if all one has to do is enter the singular and nonspecific sage mode is acquire and balance natural energy where there is even a difference between the transformation between the types of Sage Modes we know of. What causes Naruto and Jiraiya to change into their respective sage mode; what of Kabuto? The way they may acquire it is the same, in theory. But is it? All they're doing is gathering and balancing natural energy, so, reiterating -- why the change in their physiology of any form, whether markings or other? Maybe it's plot-no-jutsu but then if so, why are we coming to this point in the discussion of whether to merge or not? That in and of itself is speculation. What tells us that the Sage Mode is only one thing for each person. And what logic can you use to support that, while also explaining the differences in the physiology of the users? --98.101.165.89 (talk) 23:57, February 22, 2013 (UTC)
Read above the affinity thing, that is a possible explanation. Why they do turn animal is completely irrelevant tho, in terms of what this technique does, it should be logically even among all. There's only one kind of natural energy, A bit of speculation, but look at Jugo and the Ten-Tails, the former's body can shapeshift into multiple forms, possibly anything he wishes and his mentality is unstable. Ten-Tails is a physical manifestation of natural energy, it appears to be sentient only on a primitive level at best and it transforms as well, suggesting it's dependent on thoughts, feelings, personality etc. Eyes are the mirror of the soul after all ;D
Curse Mark users for example, Sasuke personified himself with a hawk and his form had wings and the marking on his nose could be a beak, he also managed to replace his lost wing with snakes during his fight against Deidara--Elveonora (talk) 00:48, February 23, 2013 (UTC)
It doesn't explain it, however, as there are places and people (Sages/animals) that teach it. And everything we know up until now, excluding Hashirama (which I feel, speculatory, is Slug), is that you learn it at a special place from special animal sages, and if we postulate that the 3rd place Kabuto mentioned is for the Slug sage, it only makes the case that much stronger. Why would an affinity matter? Why would the animal teachers matter, if its all the same thing? And turning into an animal isn't irrelevant, either, we were first introduced to "You turn into a Frog statue if you fail.", to what would be highly likely: "You may turn into a Snake (or dragon) statue if you fail." But it, like I stated above, comes down to what? Kabuto could've potentially learned from the frogs as much as Naruto could the White Snake Sage. But you are right in that "in terms of what this technique does" is create something, but that comes from senjutsu and not Sage Mode, I would postulate. Though I don't know how to clarify that as of this moment. Presently, I just do not see enough, or any, evidence to suggest they are one and the same, while also providing evidence to provide an example of why there are differences.
Edit: I also want to reiterate something someone mentioned above about how the... Preva path? (Tired atm) turned into a frog statue. But, excluding plot-no-jutsu, why would that happen?--98.101.165.89 (talk) 01:33, February 23, 2013 (UTC)
I for one, don't think its some sort of affinity. I think sages learn how to absorb natural energy from the specific animal they're learning it from. Natural energy comes from everything, so its logical to think that there are different types of it. It would not only explain why preta turned into a toad, but also why Jugo can change his body into multiple forms, and the cursed seals' resemblance to multiple animals. My logic behind it is that the only differences between sage modes are the ability to transform parts of the body into the animal learned from when the natural energy is unbalanced, as proven in Jiraiya's, and possibly Kabuto's case. Because other than that, they have yet to show any difference from each other. And the way I see it, that info can easily be placed separately while the shared abilities are merged into one section. MangekyoSasuke (talk) 07:29, February 23, 2013 (UTC)
That would make sense, in case if only Naruto hadn't turned toad when absorbing it outside of Mount Myōboku it does happen everywhere even in places where no toads are nearby. Also assuming there are multiple forms of natural energy isn't viable since we weren't told as such, quite the opposite, it's in the earth, atmosphere, all around. When Jugo changed his arm during the Oro revival scene, he called it his original Sage Transformation, meaning that's what it looks like when he is in control, but when he goes berserk, the forms are random. That's why I think natural energy changes them accordingly to their mental state. Kabuto turned "dragon" not because he surpassed Orochimaru, but because he only thought he did, thinking himself superior.
I don't think it matters who taught it whom, but if you associate with them.--Elveonora (talk) 14:58, February 23, 2013 (UTC)
And everything you just mentioned is speculation and what you believe happened when compared to what we actually know. Naruto learned Sage Mode from toads, hence toad if you fail, toad if you absorb senjutsu chakra and can't control it, toad like if can't balance it correctly. Kabuto learned Sage Mode from snakes, thus, snake.--TheUltimate3(talk) 15:46, February 23, 2013 (UTC)
I'm with Ultimate here. This entire argument is ridiculous. We have the three different variations of Susanoo, based on user, on its page, despite the fact that it is the same technique. All of the differences of each unique Susanoo is already listed on the character's page itself. The same should happen here. The different variations of Sage Mode should be mentioned. If anything, it should be done like Susanno was (i.e., "Naruto Uzumaki's Version", "Jiraiya's Version", "Kabuto Yakushi's Version", and "Hashirama Senju's Version") listing the things specific to each Sage Mode. Regardless of whether or not Sage Mode is the same across the board (and clearly it is not), each user has used it very differently from each other, thus far, and therefore, I think it would be a loss of information to take the sections out. And Elve, enough speculation. Use the cold-hard facts, as in what we have physically seen and heard from the anime/manga as facts, not "what-ifs". ~ Ten Tailed Fox 16:27, February 23, 2013 (UTC)
Susanoo is a different case, it's a physical manifestation of a MS user's chakra, of course it will differ between users. I agree with the "x user version" thing, would be better, a nice compromise if it be--Elveonora (talk) 16:52, February 23, 2013 (UTC)
@ Ultimate -- Correct. We know the process of absorbing natural energy is the same for all. We are not really told how Sage Mode is activated, but it is implied that it is simply by absorbing natural energy in large amounts; Naruto simply meditates and it occurs. So there's no differentiating factor for the different sage modes, and yet there are differences between them. While there may be similarities in the advantages it provides, that is due to the body flowing and being in harmony with natural energy -- a side product, if you will, instead of Sage Mode itself . Note: Sounds like speculation, could be speculation but I think based on Juugo and the other things we know about natural energy and sages it isn't speculation. But like I pointed out about Juugo and his clan, they can transform -- Juugo transforming into different things when he wants -- and their bodies and more are boosted with natural energy. The end product is "Sage Transformation", a lot like Sage Mode. The latter, however, utilizing senjutsu chakra at the end.
@ Elv -- As for Kabuto being a Dragon versus a snake, I am going to assume (speculation)it is because the idea that dragons are above snakes in a lot of Asian cultures, sometimes being the same animal but the dragon being more heavenly or godly (more powerful/advanced, in other words). Or, at least, that is what I understood when I first read the chapter, otherwise I do not think it would've even been mentioned by Kish. Kabuto may not even be perfect, based on his anatomy. Yes, some of it is due to the experiments and other things, but it also reflects the imperfect changes we've seen in Jiraiya.
At any rate, Tl;DR version: There's no evidence to suggest Sage Mode is only singular thing, with vast physical differences between how the senjutsu reacts within the users and others (Preta Path changing). Rather, it is senjutsu that provides the similar bonuses, corroborated by Juugo and dialogue from others. I postulate for now there are 3 known, different, Sage Modes as all the evidence points to that. That being said (and yes, it is turning out to be long again...) the page could reflect that in a way that combines the ability bonuses, but still makes sure to differentiate between the different modes.
Edit: Note: @Ten Tailed, I typed all of this before I saw yours--98.101.165.89 (talk) 16:58, February 23, 2013 (UTC)
@98xxxsomething, bingo, that's exactly what the topic was about before it has gone offtopic thanks to me included (just wanted to throw around some theories and opinions) it's pointless to have listed "increased strength, speed, stamina, durability etc." for every of them since it's even, that's basically having the same thing there multiple times. Also naming of each "variant" should be changed from animal to user's name as Fox suggested and I would agree with. That way, it's a neutral approach that doesn't necessarily speculate that each of them differs nor that they don't, meaning that the differences vary and depend on it's user rather than it being a different "version" of Sage Mode each time--Elveonora (talk) 17:07, February 23, 2013 (UTC)
That does seem like an appropriate compromise...listing the general benefits under one banner, while showcasing each individual mode showed by it's user, rather than repeating them over and over. Darksusanoo (talk) 17:21, February 23, 2013 (UTC)
Here's something some of you are forgetting: Sage Mode improves the user's natural abilities. For example, Fukusaku thought to himself that Naruto's healing rate had been vastly improved because of both Kurama and Natural energy. Kabuto becoming a 'Dragon' was, as we know, because of the whole dragons being (basically) super snakes, referring to him surpassing Orochimaru. Again, Sage Mode is just balancing Nature's energy with the energies within the medium, imrpoving their own innate abilities. Kabuto developed NO new snake-related abilities as a result of Sage Mode. The jaw thing was done sans-Sage Mode to swallow up Yamato on the Island Turtle. He gained the sensor-type chakra detection, as per dodging Susanoo's arrow. Everthing I recall Kabuto doing non-jutsu-wise was simply improved snake-esque abilities. Sage Mode appears to be more related to Toads anyways, considering failing to maintain adequate control over the energy results in becoming a petrified toad. Skitts (talk) 18:09, February 23, 2013 (UTC)
If that were true, neither the Ryuchi Cave, nor the White Snake Sage would exist...from where it stands the animal traits a Sage Mode user gains are dependant on which animal sage trains them, but that's about it. The benefits they gain have so far been mostly the same. As for the sage techniques themselves, it's obvious each sage has learned/developed their own techniques from sage mode. Darksusanoo (talk) 18:23, February 23, 2013 (UTC)
But that's just it, Kabuto was already snake-y prior to Sage Mode, so I don't really see what snake traits he acquired that he didn't already have, from scales to belly tail (lool). All that happened was he got.... horny. :) Skitts (talk) 18:35, February 23, 2013 (UTC)
Lol, funny...The snake brille, the way he cracked open his jaw to catch sasuke...when he did that to Yamato, he had to change to a completely new form...when Jiraiya faced Nagato, he changed the shape of his hands and feet into toad ones for increased mobility...he had snake anatomy before, but that doesn't mean he couldn't gain further access to it through Sage mode. Darksusanoo (talk) 18:57, February 23, 2013 (UTC)
I think we're talking past each other. :) I'm agreeing with that last part you said. Sage Mode enhances the user's innate abilities as well (Fukusaku said it increased Naruto's healing rate, for ex.), and Kabuto already basically was a snake, so no surprise in that department. Skitts (talk) 19:19, February 23, 2013 (UTC)
Yeah, I feel like the topic is over, half of it is garbage and the relevant stuff has been concluded, I will try to cook it up later on (when I feel like it) accordingly to the proposal--Elveonora (talk) 19:26, February 23, 2013 (UTC)
The benefits are the same, but I want to make sure it's understood that it isn't sage mode in and of itself, but senjutsu that provides the bonuses to enhanced physiology, etc. As well as Toad Sage and Snake Sage are different Sage Modes in how they work, normal senjutsu bonuses aside (that Sage Mode doesnt exist by itself). While Kabuto may exhibit some more Orochimaru characteristics, his form differs from a normal person while in Snake Sage Mode. At some point Orochimaru may have altered himself to fit the Snake Sage persona, as well, if we go by why he wants a new body to use sage mode. The horns may be the sign of a True/perfect Snake Sage, going on what Kabuto says. And while it may be speculation, I do think we can agree that a Snake Sage wouldn't be able to perform any Toad Sage abilities, and vice versa. Kabuto also, during Hakugeki, is able to use his Snake Sage abilities (cornea; not including the modifications from Suigetsu and etc) to allow him to function while Sasuke and Itachi are rendered useless. There are many things to remember to distinguish and separate, and I just would not like them to be lost and for the page to reflect that there's only one actual mode when it's not the case --98.101.165.89 (talk) 21:51, February 23, 2013 (UTC)
Bruh, Just leave it the way it is, it's more understandable. For all I care, Naruto and Jiraiya learned Sage Mode from the toads and so therefore has the support (summoning) and trait-like from the toads and that Kabuto and maybe Oro learned Sage Mode from the Snakes and therefore has the support and also trait-like that of a Snake ..... —This unsigned comment was made by 75.170.19.115 (talk • contribs) .
@98.101.165.89 Erm, nuuu. For one, we've never seen a 'regular person in snake Sage Mode', so don't know where you got that from. So far, the only potentially valid variation brought up in support of a distinguished Sage Mode has really been Kabuto's cornea, and even that has been decently shown to be explainable given what else we know about Sage Mode enhancing the user's abilities. Everything else so far has been mere mention of different techniques, which is a non-issue considering there are innumerable ways to manipulate one's chakra to do different things, even within the same class/sub-class of techniques (ex: Wind Release: Rasengan & Wind Release: Rasenshuriken). So basically my suggestions are the following:
Group everthing into 2 sections, "Imperfect Sage Mode", and "Sage Mode". The former's contents are obvious. The latter however should initially go over the know benefits of Sage Mode, increased jutsu strength and bodily prowess (speed, sensory perception, etc), Chakra-sensing, Amplified innate abilities, etc. I think a good compromise would be to indicate the somewhat uncertainty that some here have of there being possibly distinct SM flavours. But really, that slight uncertainty shouldn't be dictating the structure of the article, and reduce the large amount of redundancy currently in it. Skitts (talk) 05:43, February 27, 2013 (UTC)
@Skitts -- Thankfully you misunderstood what I meant by normal/regular person. I meant just that -- a normal or regular person -- not a sage. And there are plenty of variations, moreso on the speculative side however, that are either outright stated or could be inferred. Though I do not wish to go back into redundant topics; and to ignore what has been established, the different modes, despite the fact there's no support for the concept or idea of one singular, global sage mode, nor is it even suggested in Naruto, seems foolhardy, IMHO. Until there's more information available regarding the validity of those claims (Sage Mode being just Sage Mode and there's absolutely no differences between the types (which logically doesn't even make sense given the fact they exist)), or any other ideas regarding it: I think the article should continue as it is with slight alterations to clean it up and make it more concise, less redundant; not to the extent of changing the meanings of things, however. --98.101.165.89 (talk) 20:09, February 27, 2013 (UTC)
But I've seen nothing inferring the existence of different kinds of Sage Mode. You don't assume a difference without a stated reason/heavily implied distinction in the series. Based on what both Fukasaku and Kabuto have said, Sage Mode = Balancing natural energy with your own to increase overall prowess, QED, nothing else. Therefore that's what it is. Technique sub-classes (i.e "White Rage") are a non-issue. If you and I are going to continue, let's do it via our Talk pages (it'd be nice if you registered ;-D) Skitts (talk) 20:26, February 27, 2013 (UTC)
Off-topic - I used to be registered but I cannot remember the name I used, and cannot even find it within my emails. I could do it again, I suppose, after this (because I feel it needs to be public). On-topic: Yes, Sage Mode is balancing natural energy to form senjutsu within the body to activate Sage Mode. Sage Mode is more of a concept or theory, the way I try to describe it. Practically, there can be thousands of Sage Modes, but there's not one global Sage Mode which encompasses the others, sans animalistic difference. That is why it is important to distinguish that it is Toad Sage Mode, Snake Sage Mode, etc. Regardless if the process is the same, the results are different, for whatever reason. Toad Sages come out to be the same, Snake Sages are the same, etc. So until there's more information that supports a hypothesis that each sage mode is identical and irrelevant in relation to animals/physiological changes (which, again, is contradictory since there are varied differences regardless of techniques (though it still can apply in some cases), then it (the page) should reflect as it is now, with the alterations of removing the redundancy found within. --98.101.165.89 (talk) 01:40, February 28, 2013 (UTC)
(My Last response unless someone different pipes up) Again, you're assuming a distinction ithout a stated difference in the series, Heck, it was never said by Kabuto that he had mastered 'Snake Sage Mode', simply that he mastered Sage Mode. Kabuto already had his snake traits prior to Sage Mode, so you can't claim it to account for the whole shebang there. And as I said earlier, failing to maintain control over Natural Energy itself results in a Toad transformation, nothing else, a la Jiraiya. Since no actual distinction between practicioners has even been implied (only different teachers) it shouldn't be implied in the article methinks. Skitts (talk) 03:38, February 28, 2013 (UTC)
It was heavily implied, if not outright stated, that Kabuto achieved perfection in regards to Snake Sage Mode, going so far as to talk about the journey, about how he became more than a snake, that he became a dragon, blah blah blah. He had snake traits, but that's irrelevant to the topic at hand, as, for instance: his horns were more than likely not a product of his experiments. It also helped to prove that he became a dragon, which, if we go by standard and general Asian lore (meaning collective, non-specific), dragons are above snakes, and the horns signify that -- so no speculation or assumption. Otherwise, Kish wouldn't had drawn horns on him, or even mentioned the bit about the dragon, etc. Again, we are not discussing his pre-existing condition, but rather that which changed during his sage mode event. You can say it earlier, but I would highly doubt a Snake Sage in training would turn into a frog if he fails to balance the energies inside his body. That simply wouldn't make sense with the snakes, nor with the plot regarding it. I am not sure at what point there is a discourse in the understanding of any of it. And as I said earlier, the process may be the same, but the result is different, otherwise they wouldn't be a difference to even show in the body/eyes/anywhere else, blah blah blah. It is cumbersome to reiterate the same things, and I mean no offense with that. --Taynio (talk) 05:52, February 28, 2013 (UTC)
If it was stated/heavily implied (it wasn't) post a reference please. But really, I'm doubtful you've read the above convos, because I think I've stated everytime how to account for Kabuto. For one, he never mentioned a different Sage Mode. The mention of the journey? Okay? He just said that he ventured to Ryuchi Cave to learn Senjutsu from the Snake Sage, that said nor implied anything about a different Mode. And again, horns are easily accounted for. For the like 4th time, Sage Mode increases your own innate abilities. Naruto's healing rate was even greater in SM (chapter 415, page 14). Kabuto was snake-y prior to SM, hence entering it caused him to transcend snake to 'dragon' (clearly a simple nod to Asian folklore). And again, Natural Energy is natural energy, it recognizes no divisions based on teacher. Fukasaku plainly said that failing to keep it under some amount of control (and/or not having a large chakra supply already) would result in becoming a Toad and possibly petrifying, which we've seen happen to the Asura Path. And visual differences would seem of little use here. Heck, Jiraiya's appearance was crazy and didn't really resemble Naruto's at all. Kabuto's appearance was chiefly as it was because of his DNA integration, mostly Orochimaru's. We have no clue what a non-DNA hoarder would look like if it is the case that there are different SMs. Skitts (talk) 13:05, February 28, 2013 (UTC)
I just see too many of the same errors to keep replying to over and over; it's no use to keep reiterating the same things just to have the same, and I'm sorry to say this. but invalid things coming back. Perhaps the biggest two issues being that anyone who practices your proposed sage mode turns into a frog, which makes utterly no sense. Secondly being the horn issue and the fact you keep missing the distinction and difference between pre-exisiting conditions with Kabuto and his condition post-sage mode, which you even throw up to his modifications, which make no logical or rational sense; and completely throwing out any and all in-sage-mode identifiers that one would have, such as Jiraiya, Hashirama, or Naruto. You're too caught up, as a lot of others, on his modifications and how much power they offer him, which is being overestimated relative to this topic. Though for a third, you fail to recollect that Jiraiya wasn't perfect, which was the cause for his toad like appearance (and to-note: that which identified him as a sage, DID match Naruto). It's just really not worth it at this point; and I have read every edit on this page, as I do every page I come across, that is how I learn and form my arguments, otherwise it would be an incoherent mess
However, the good points: Yes, natural energy as senjutsu does great things for the body and techniques, this has been long established, but is irrelevant. And if it makes no difference, then why the visual differences, which you say hold no bearing? Why the different teachers? Etc. I could go gon and on with question that hasn't been answered by any.--98.101.165.89 (talk) 14:36, February 28, 2013 (UTC)
What we know for sure is, that that pigmentation around eyes is a sign of a true Sage. The problem is, everything we know points to a single technique so does logic, yet they turn different animals for some reason, this is being justified as different Sage Modes while we can't conclude as such since it makes no sense. That's like saying if Ino were Kurama's Jinchuriky, her forms would resemble a boar--Elveonora (talk) 14:47, February 28, 2013 (UTC)
Off-topic: Hi Elv! I actually enjoy talking with you, lol. On-topic: I would concede that was true, that "What we know for sure is...". I could agree on that, despite everything, and that isn't to recant everything I've said but just as "if my life depended on it" lol. Regarding the second point, however, I while a single technique and process, the results are different, as you do point out and I agree, but logic in these circumstances is actually circumventing the former because if it is the technique, but the differences are so wildly varied, yet students of the same order (toad, snake, etc) exhibit similar, almost identical changes which are different from others, then logically they are not the same in relation to the results, but not the process (because all that is happening is they gather natural energy to form senjutsu to enter their sage mode). And that's the key here, that logic must always be applied to the entirety and what holds precedence over the other. I want to emphasize, however, I am not saying they are different techniques, as I think still people believe I am stating. The technique to enter the mode and the process in doing it is the same, but the concept or theory of sage mode versus the practicality (or application, if you prefer) of it is completely different. And that's where we don't know where it differs or why, yet the fact remains it does differ. But to end this off with something I've said before, which I think mirrors exactly the general idea people have, we should definitely remove the redundancy in the article, but not to the degree that each version loses its uniqueness, or to perpetuate irrelevant ideas about sage mode (by trying to combine them) until more information is available. -98.101.165.89 (talk) 15:01, February 28, 2013 (UTC)
@98.101.165.89 You say you see errors in my reasoning, where? It was stated directly by Fukasaku (and demonstrated against Pain) that not controlling Nature's energy = becoming a Toad or worse. Kabuto mentioned nothing about it, hence no distinction is to be assumed. And I've not forgotten that Jiraiya had an imperfect SM. My point was was the fact that Jiraiya's facial appearance as a result of the mode wasn't fixed while in that state (the blood contract changed at least once, I do recall). If you have indeed read every post you wouldn't repeat what I've already gone over. Since Jiraiya failed to perfectly balance his Senjutsu chakra, he gained Toady attributes. Kabuto already had snake attributes, so SM was obviously not the origination of them like it was for Jiraiya. You're making false comparisons. Again, the horn thing is just a nod to the whole dragons being greater snakes in asian lore, as well as the fact of DNA integration. Also, we don't actually know if Hashirama mastered Sage Mode, it's just an assumption we're making (I'm willing to accept it). We don't actually know if they differ, which is the whole point. Kabuto is a rather special case considering his condition prior to the Mode, so your affirmative assumptions without the actual distinctions stated in the series are going too far at this point. So in doing what the wiki usually does, we shouldn't have the article making somewhat arbitrary divisions. Find a place where the divisions is made apparent, post a link for us to verify, otherwise I don't see any actual motive for this. Skitts (talk) 18:06, February 28, 2013 (UTC)
First off, about the "arbitrary divisions", that is the least speculative way to go about it. It is also the way of the wiki not to doctor up something based on a hunch without sufficient information, which is what you seemingly propose. I have been on this wiki, as many have, for many years. I am quite familiar with it. I just wish I remembered my name (or in the case it was deleted or something because my name is about 100% the same anywhere).
I pointed out the errors. And I shouldn't have to post a link as I go to elaborate lengths to explain, and it isn't hard to even look for yourself and re-read the pages where it applies. I mean, what would it help? You remember the pages, correct? The imagery, the words, etc? I can do it, but I fail to see how it would help when the pages and the chapters revolving around the content are small enough to memorize, and it is nice to familiarize ones's self with the pages when discussing it anyways. If you truly will not even consider something with well formed arguments, what are the linking the same pages that you most likely remember vehemently going to do? Especially after all of this discussion about it from everyone, with more than a few very well-formed arguments from them.
It was stated by him (Fukasaku), but there's no inclination to believe all people who train in senjutsu turn into toads, otherwise why Toad Sage teachers? Why have any difference in 3 of the 4 known human sages? I keep reiterating this and yet no rebuttal is brought forth. We could just have all people who dabble in sage mode become Toad Sages, and be taught by Toads. But there is a Snake sage, and given that, plus the fact they will teach humans, there would be a lot of parallels with the frogs. That's a generally understood concept. But also notice I am not saying to put it into the article, because it hasn't been introduced. I am not as foolish and ignorant as you believe I am, or have the lack of motivation to read all of the edits. That isn't the topic of discussion, however. And just because you keep going over it, same as I, doesn't mean either of us are correct or that both of us didn't read anything.
Jiraiya was imperfect, yes, and you did, at least in text form if not memory, forget about that, or you did not clarify, at least. You suggested Jiraiya was perfect and that the reason for the difference compared to Naruto was that sage mode is peculiar, essentially. To quote, "Heck, Jiraiya's appearance was crazy and didn't really resemble Naruto's at all. ", and given the context combined with the rest of the sentences surrounding it, that's how it came out. It did resemble it, however, in his eyes. Jiraiya's frog-like features were a result of him being unable to perfectly balance natural energy and his own, not a result of just having sage mode activated. But as for Kabuto, yes, he already had them due to modifications a la Orochimaru. Yes, that's been quite established, by others and myself. The difference, and the error, however, is the overwhelming power of emphasis you give it relative to sage mode; the two are not related. Kabuto's horns are a nod to Asian folklore -- I'm the one, IIRC, that first brought it up, unless I missed it in someone's earlier edit. But that doesn't mean it is just a nod. We would infer that without having Kabuto being so excited about being a dragon and not a snake; or that Orochimaru (the snake) also learned from the Snake Sages, which suggests that, similar to anyone learning from the Toads, or wherever Hashirama learned his, they will exhibit signs relative to where they learned it. He actually isn't a special case when it comes to the mode, and that is highly speculative you believe so. On the contrary, it isn't, and shouldn't be special. Yes, he is modified, but with what rational do you assert that makes a difference at all? I don't understand why, despite me profusely emphasizing his pre-existing condition pre-sage mode, that you think I believe it is a result of sage mode. I NEVER suggested that. So no, there are no false comparisons. I am unbelievably aware, and have continuously stated, my understanding, at great, pain-staking lengths, of the differences of Kabuto and imperfect Toad Sage Jiraiya. I am astounded. Regardless of how you feel, there are things which cannot be denied when it comes to the different products resulting from the same technique. What we don't know is how it happens. There are divisions, but you are seemingly blending them, or outright ignoring them. The fact there are so many differences resulting from the same technique (sans basic improvements from senjutsu (improved strength, etc; improved ninjutsu, etc)), even if the differences are only visual (which is just as huge as anything else), suggests a division. Even if you don't believe in a difference between Kabuto and the Toads Sages, then explain Hashirama, who has no pre-existing condition and yet changes beyond what we have seen from the Toad Sages and Snake Sages.
And you are right, we don't know if Hashirama is perfect. I never suggested he was. And the only reason people believe Kabuto is perfect is because of his speech to Itachi and Sasuke about how he became a dragon instead of a snake like Orochimaru, which, given the folklore and just general comparison (you do not even have to know about the folklore) that Kabuto was making, suggests the top/best. But he could be imperfect for all we know, since it isn't directly stated. He could've, hypothetically, even been in sage mode the entire time given his modifications based on Juugo. But I am not suggesting that, if that's what you believe.
I truly am done at this point. When it has gotten to a point I feel the need to write so much, I need, personally, to stop; it's gotten out of hand with all of the assumptions you believe I am making, the assumptions I do not read, etc. I have no patience for it anymore. If you still, at this point, would like me to post links to the chapters for you, even though they honestly will do nothing to aid, that is something I would do on your talk page. --98.101.165.89 (talk) 20:15, February 28, 2013 (UTC)
I just believe we need to remove speculation and use neutral labels since we can't confirm nor deny some things. But I'm pointing out, that Hashirama supports my hypothesis. I believe natural energy changes everyone in a different way and the resulting form is what they resemble the most/are associated with, there's more that hints on this (look at curse mark users, they don't turn into snakes, do they? Also Jugo Clan's members were also shown each with a different form)
Even perfect sages get animal eyes of a species, yet, Hashirama's eyes didn't change at all, he just gained the pigmentation (true sign) and a marking on forehead resembling the third eye, thus it has nothing to do with animal trainers at all, rather does with users themselves. The same thing can't have different effects on individuals, that's nonsensical, rather each individual reacts to it differently. Instead of "x type sage mode" it should be "x user in sage mode" there's only 2 official forms, perfect and imperfect.
And as stated, many things repeat in the article, there's the same advantages&disadvantages for everyone by default, the differences stem from their unique workarounds/countering only, like the shoulder-merging-no-jutsu and insert jugo dna so you don't have to sit all day thingy--Elveonora (talk) 21:09, February 28, 2013 (UTC)
Since the previous section didn't amount to... anything (my bad). So, is the article going to be restructred or not? No one seemed to come to any overall agreement in regards to the technique. Skitts (talk) 00:32, March 1, 2013 (UTC)
The way I see it, the article should be re-structured like this:
Sage Mode
stuff in common with all sage modes (main, or at least, original complaint was redundancy)
increase in power of nin,tai,genjutsu
cloak of natural energy
ability to sense chakra
increase in reflexes/perceptual abilities (yes its the same thing, naruto could dodge the raikage's impossibly fast spear, kabuto could dodge sasuke's impossibly fast arrow)
note differences based on animal/where taught
different characters uses
This way, redundancy is reduced while keeping things seemingly unique separate. Hope this makes people happy. MangekyoSasuke (talk) 01:23, March 1, 2013 (UTC)
I support the proposed restructuring proposed to cut down the redundancy. Omnibender - Talk - Contributions 22:57, March 2, 2013 (UTC)
I agree with the cutting of redundancy. I remain against the removal of the Toad, Snake, whatever the hell Hashirama is.--TheUltimate3(talk) 00:27, March 3, 2013 (UTC)
Cool, who is bored?--Elveonora (talk) 05:04, March 3, 2013 (UTC)
I'm somewhat bored (and ill) now, and no work today, so I suppose I could do it. :-) Seelentau thinks we should as well (my talk page). He could only think that we should split the article based on user. @TU3 Would Seelentau's or MangekyoSasuke's suggestions satisfy? :) Or how about these?:
The opening section of the article already does a decent job going over the general abilities of Sage Mode, so it would a good place to make use of in reducing some redundancy.
First section, Mt. Myoboku (or something better any of you think of), which would go over the practicioners that learned from Mt. Myoboku. First sub-section would be over Jiraiya's imperfect usage (Imperfect Sage Mode), while the second over the balanced usage of the technique (True Sage Mode). Or perhaps we should divide it into Balanced and Unbalanced, referring to the Natural energy?
Create 2 more sections, Kabuto Yakushi and Hashirama Senju, to list any current or future quirks (if any) of their respective usages.
Note in the trivia that we don't currently know if these are distinct Sage Modes or user specific oddities.
I think that may satisfy those of us who disagree as to the nature of the technique. Thoughts? Skitts (talk) 15:17, March 3, 2013 (UTC)
Sounds okay, an action should be made first and only then disagreements and displeasure might come of it--Elveonora (talk) 15:31, March 3, 2013 (UTC)
Please do not differ between imperfect and true sage mode, since that would sound like there is more than one sage mode. Jiraiya is in sage mode, Naruto is in sage mode. The only difference is that Naruto can use it better than his sensei. He simply has more control over the natural energy balance in his body, that doesn't make his sage mode anything different. Write something like "Since Jiraiya has no complete control over the natural energy in his body, he looks more like a toad than Naruto does, who can maintain a perfect balance of the three energies.". As I said on your talk page, Skitts, there is only one Sage Mode, there's no perfect or snake or dragon sage mode. Seelentau 愛議 15:45, March 3, 2013 (UTC)
Yeah, still, sounds less fanmade than "animal mode" xD "Perfect balance" and "Partial balance" sounds like terms that should be used imo
EDIT: the article should cover only the technique itself, those bodily changes and shit aren't a part of the technique, more like a consequence of failing to balance natural energy perfectly and should be covered elsewhere--Elveonora (talk) 15:58, March 3, 2013 (UTC)
It's simple: The more balanced the three energies are, the less froggy are the looks of the user. This goes from turning into a frog to somewhat looking like a toad to having eye shades. And you are wrong, the technique describes the effects of natural energy in a human body. The looks are a part of those effects, thus they should be covered in this article. Seelentau 愛議 16:01, March 3, 2013 (UTC)
Yes, in the user section but not as a part of "powers" description. But I believe these changes belong more here Natural Energy since natural energy is responsible for physical changes outside of sage mode--Elveonora (talk) 16:03, March 3, 2013 (UTC)
Of course not in the powers-part of the article. But there are no physical changes outside of the sage mode. Going into Sage Mode means absorbing natural energy, which may result in physical changes if the natural energy isn't in balance with the other two. The physical changes are a direct result of absorbing natural energy. Seelentau 愛議 16:07, March 3, 2013 (UTC)
(Edit conflict time SIX)
@Seelentau I didn't say they were different techniques, which is why I also recommended dividing the Myoboku section into Balanced/Unbalanced, to indicate skill difference. :-P Oh and since the effects of Sage Mode are directly relevant to the technique (axiomatically), they belong here. Skitts (talk) 16:10, March 3, 2013 (UTC)
@Tau, I'm talking about Jugo and his clan, their enzyme isn't responsible for their bodily changes alone, it's the catalyst that causes their bodies to respond to natural energy differently than "ordinary" people do, without it, they would turn into a statue. The "body altering" thing is an attribute of natural energy in general--Elveonora (talk) 17:21, March 3, 2013 (UTC)
I still have ever intention of noting the the Toad, Snake, whatever the hell Hashirama is.--TheUltimate3(talk) 17:53, March 3, 2013 (UTC)
I think this one is gonna go down as the longest discussion of this wiki. That aside i'm also in favor of the re-structuring of the article to remove redundancies, at least those that are ability related. Either way since most appear to be in favor, why not just start? Darksusanoo (talk) 22:09, March 6, 2013 (UTC)
Has anyone come up with a draft yet? MangekyoSasuke (talk) 22:12, March 10, 2013 (UTC)
Just wondering, wouldn't an explanation of Naruto being capable of creating Rasengan without a clone and in one hand or even two in each at the same time, be a proof of Sage Mode improving chakra control as well?--Elveonora (talk) 14:57, March 11, 2013 (UTC)
Sage Technique: Spiralling Serial Spheres: Can assume he didn't have a clone, but considering we didn't know he was making the Rasengans until the Animal Path was inside the toad's mouth, we don't know.
It is also worth noting that someone stated somewhere at some point that Naruto could make Rasengans without clones in Part II, but by that point just preferred to use clones. It was also stated at some point by someone somewhere that Kishimoto just didnt care enough to draw another clones in every picture.--TheUltimate3(talk) 00:08, March 13, 2013 (UTC)
Nice explanation, then perhaps we should remove/change some instances that mention he can't due to poor chakra control and stuff. Actually his chakra control has become very good by now, so it even makes sense that it's simply his style, not limitation, if we have references, that's it. I think he did in anime or movies, but that's not much canon, but perhaps could serve enough--Elveonora (talk) 00:15, March 13, 2013 (UTC)
The one issue I have with Ultra-Big Ball one is that it was done in the mindscape, not actual real world. Omnibender - Talk - Contributions 01:07, March 13, 2013 (UTC)
Very true, just thought something was fishy about this, that's why I brought it up, but since there's not much evidence for that...--Elveonora (talk) 15:34, March 13, 2013 (UTC)